BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D19 (447 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0961 + 8070992-8071015,8071016-8071089,8073051-8073200,807... 27 6.9 08_02_0685 + 20039318-20040433,20040574-20040982,20042906-200429... 27 9.1 >07_01_0961 + 8070992-8071015,8071016-8071089,8073051-8073200, 8073307-8073592,8074077-8074220,8074357-8074665 Length = 328 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 324 KFLFYVVLVWFKIWGQMVFKIGQNYLFSYK 235 KF+ +V+ W ++ IG + FSYK Sbjct: 164 KFIIIKSVVFLTYWQMLIAAIGHQFAFSYK 193 >08_02_0685 + 20039318-20040433,20040574-20040982,20042906-20042973, 20043336-20043518,20043641-20043964,20045653-20045694 Length = 713 Score = 26.6 bits (56), Expect = 9.1 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = -3 Query: 295 VQNLGPNGLQNRSKLFV*L*GHTFQILSYTSVKLNRFLK 179 + NLG + +N L++ L GH F + Y +++L RF+K Sbjct: 661 LMNLGSD-FENMGYLWLAL-GHFFLVAPYAALRLRRFIK 697 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,715,964 Number of Sequences: 37544 Number of extensions: 130826 Number of successful extensions: 162 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 859680288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -