BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D13 (587 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0676 - 5511755-5511831,5512857-5513052,5513462-5513577,551... 28 4.8 05_01_0372 - 2913518-2916562,2916674-2917528 28 4.8 >11_01_0676 - 5511755-5511831,5512857-5513052,5513462-5513577, 5513752-5514597,5515515-5515766,5522344-5525206 Length = 1449 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = -2 Query: 463 SCPFLKSFFFTLNNILSFHINFIS*LEIIDCKQVFRGLFDDHAFSC 326 SCP LK +FT N +S I C +F FD++ C Sbjct: 1284 SCPALKELYFTKNCGFDSVYEILS--RSIQCLHIFHCQFDEYCDGC 1327 >05_01_0372 - 2913518-2916562,2916674-2917528 Length = 1299 Score = 28.3 bits (60), Expect = 4.8 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +2 Query: 323 PAGESVIVKESTENLFTVDDFKSANEIYVKAQNIVEGKKE 442 P V+ESTE TVDD S +V A++ VE E Sbjct: 297 PVSAESAVEESTEKEQTVDDTSSEMIAHVSAESAVEESTE 336 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,773,388 Number of Sequences: 37544 Number of extensions: 289946 Number of successful extensions: 665 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1388195172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -