BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D07 (546 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3G6.09c |tps2||trehalose-phosphate synthase Tps2 |Schizosacc... 26 3.2 SPAC22H10.12c |gdi1|sec19|GDP dissociation inhibitor Gdi1 |Schiz... 26 4.2 SPAC1486.03c |||RNA-binding splicing factor|Schizosaccharomyces ... 25 5.5 SPAC869.07c |mel1||alpha-galactosidase |Schizosaccharomyces pomb... 25 5.5 SPBC405.06 |||DNAJ protein Xdj1 |Schizosaccharomyces pombe|chr 2... 25 7.3 SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe... 25 9.6 SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosacchar... 25 9.6 >SPAC3G6.09c |tps2||trehalose-phosphate synthase Tps2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 849 Score = 26.2 bits (55), Expect = 3.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 459 QWDDWLHRNDVPNLCTGP*IFLHTLSRHLLPSILHQQ 349 +W + N V N G I +H S LLP ++ +Q Sbjct: 202 RWSQYFADNIVSNYRPGDLILIHDYSLFLLPRLIRKQ 238 >SPAC22H10.12c |gdi1|sec19|GDP dissociation inhibitor Gdi1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 440 Score = 25.8 bits (54), Expect = 4.2 Identities = 7/27 (25%), Positives = 18/27 (66%) Frame = +1 Query: 217 GLNRNWIIRILPTFGFGNRDILSMIVF 297 G +R+W + ++P F N D+ +++++ Sbjct: 66 GRDRDWCVDLVPKFLMANGDLTNILIY 92 >SPAC1486.03c |||RNA-binding splicing factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 797 Score = 25.4 bits (53), Expect = 5.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 261 IWKQRYFVNDSFFDYKN 311 +WK YF+ +SF +KN Sbjct: 378 VWKHPYFMLESFLSWKN 394 >SPAC869.07c |mel1||alpha-galactosidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 436 Score = 25.4 bits (53), Expect = 5.5 Identities = 12/39 (30%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -2 Query: 428 FQIYAQGLKFFCILYPGTFYHPSCISSTFS---TDHQKY 321 F +Y+ K+ C +PG+ H + TF+ D+ KY Sbjct: 115 FGMYSSAGKYTCAGFPGSLNHEQIDADTFADWGVDYLKY 153 >SPBC405.06 |||DNAJ protein Xdj1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 413 Score = 25.0 bits (52), Expect = 7.3 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -2 Query: 98 CDNKNVKSHIKH 63 CD K VK H+KH Sbjct: 167 CDGKGVKQHLKH 178 >SPAC16A10.01 |||DUF1212 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 830 Score = 24.6 bits (51), Expect = 9.6 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 383 PGTF-YHPSCISSTFSTDHQKYGPRIFVVKKT 291 P TF Y P C+ F Q Y P +FVV+ T Sbjct: 430 PATFLYLPDCMFVYFKKLEQ-YSPDVFVVRVT 460 >SPAC9G1.10c |||inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1191 Score = 24.6 bits (51), Expect = 9.6 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +3 Query: 330 MIGGEGAADARWMVKGAWIEYAKKFK 407 M+ + +VK WIEYA +FK Sbjct: 1127 MVNAQSQGSTWDVVKRKWIEYADEFK 1152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,415,527 Number of Sequences: 5004 Number of extensions: 53691 Number of successful extensions: 130 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -