BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D05 (581 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 23 2.2 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 23 2.2 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 23 2.9 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 3.8 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 6.7 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 8.9 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -2 Query: 160 LNISSVPWDHVEARARRCSGGVSAGKRHHRCN 65 ++I+ +D + R CSG +S K CN Sbjct: 43 VHITKDEYDEIGRLKRTCSGDISVTKCEGFCN 74 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 23.0 bits (47), Expect = 2.2 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -2 Query: 160 LNISSVPWDHVEARARRCSGGVSAGKRHHRCN 65 ++I+ +D + R CSG +S K CN Sbjct: 43 VHITKDEYDEIGRLKRTCSGDISVTKCEGFCN 74 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = -2 Query: 127 EARARRCSGGVSAGKRHHRCNCYYVSEHHLFYKFQGGRLSDE 2 +A R V A + +C Y++ L Y F R+ D+ Sbjct: 320 DASERNPRSAVLAAREITSSSCSYMAHEKLSYAFSVWRMEDD 361 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 216 IPLTWLSAAKHPKTKWP 266 IP+T + KH KTK P Sbjct: 210 IPVTLTTVPKHSKTKSP 226 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -2 Query: 193 SCSDGVRRWYCLNI 152 SCSD + RW L + Sbjct: 434 SCSDKIARWNVLGV 447 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +2 Query: 476 IVKSYAVFWVGIESAP*R 529 ++ S+ FW+ E+AP R Sbjct: 259 VIMSWVSFWIKPEAAPAR 276 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,394 Number of Sequences: 438 Number of extensions: 3501 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -