BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D05 (581 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52550.1 68418.m06525 expressed protein 30 0.98 At2g02120.1 68415.m00148 plant defensin-fusion protein, putative... 29 1.7 At5g10080.1 68418.m01168 aspartyl protease family protein contai... 29 3.0 At5g50200.3 68418.m06216 expressed protein similar to unknown pr... 28 4.0 At5g50200.2 68418.m06218 expressed protein similar to unknown pr... 28 4.0 At5g50200.1 68418.m06217 expressed protein similar to unknown pr... 28 4.0 At5g06580.1 68418.m00743 FAD linked oxidase family protein simil... 27 6.9 At4g04920.1 68417.m00715 expressed protein 27 6.9 >At5g52550.1 68418.m06525 expressed protein Length = 360 Score = 30.3 bits (65), Expect = 0.98 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = -2 Query: 196 DSCSDGVRRWYCLNISSVPWDHVEARARRCSGGVSAGKRHHRCNCYYVSEHH 41 + C D R PWD+ + SGG++ H RC+ Y V +++ Sbjct: 250 EDCDDSYRNTLNQETGFKPWDYT-TKINLFSGGINRFFPHQRCSSYAVHDNN 300 >At2g02120.1 68415.m00148 plant defensin-fusion protein, putative (PDF2.1) plant defensin protein family member, personal communication, Bart Thomma (Bart.Thomma@agr.kuleuven.ac.be); contains a gamma-thionin family signature (PDOC00725) Length = 77 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = -1 Query: 314 SKCRRSCHPDELPGG-CRPFCLRVFC 240 + C CH + PGG CR F R FC Sbjct: 48 TNCENVCHNEGFPGGDCRGFRRRCFC 73 >At5g10080.1 68418.m01168 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +2 Query: 104 GAPPSACF-DMIPGHAADVQTVPAPYTITTAVSSVKAGHSIDVVISGKTP 250 G PS C D I A + +P + T + GH++ I+GKTP Sbjct: 447 GWSPSKCQEDKIEPPQASPGSTSSPNPLPTDEQQSRGGHAVSPAIAGKTP 496 >At5g50200.3 68418.m06216 expressed protein similar to unknown protein (pir||T05562) isoform contains a non-consensus AT acceptor splice site at intron 1 Length = 210 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 380 HKMHAKELDRQTVSYPWTAPKDLEGDVVFKVTIVKSYAVFWVGIESA 520 HK+ AK D+ S WT +D+ F V++YAV +G E A Sbjct: 110 HKIIAKPYDKTLQSTTWTLERDIPTGTYF----VRAYAVDAIGHEVA 152 >At5g50200.2 68418.m06218 expressed protein similar to unknown protein (pir||T05562) isoform contains a non-consensus AT acceptor splice site at intron 1 Length = 210 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 380 HKMHAKELDRQTVSYPWTAPKDLEGDVVFKVTIVKSYAVFWVGIESA 520 HK+ AK D+ S WT +D+ F V++YAV +G E A Sbjct: 110 HKIIAKPYDKTLQSTTWTLERDIPTGTYF----VRAYAVDAIGHEVA 152 >At5g50200.1 68418.m06217 expressed protein similar to unknown protein (pir||T05562) isoform contains a non-consensus AT acceptor splice site at intron 1 Length = 210 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 380 HKMHAKELDRQTVSYPWTAPKDLEGDVVFKVTIVKSYAVFWVGIESA 520 HK+ AK D+ S WT +D+ F V++YAV +G E A Sbjct: 110 HKIIAKPYDKTLQSTTWTLERDIPTGTYF----VRAYAVDAIGHEVA 152 >At5g06580.1 68418.m00743 FAD linked oxidase family protein similar to SP|Q12627 from Kluyveromyces lactis and SP|P32891 from Saccharomyces cerevisiae; contains Pfam FAD linked oxidases, C-terminal domain PF02913, Pfam FAD binding domain PF01565 Length = 567 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -3 Query: 351 LRGCEKV-SSGLTVQVPTILSP*RASRRMPAILSSGVLPL 235 LR C ++ S+ + T+LSP + RR+P SS + PL Sbjct: 17 LRPCRQLHSTPKSTGDVTVLSPVKGRRRLPTCWSSSLFPL 56 >At4g04920.1 68417.m00715 expressed protein Length = 1250 Score = 27.5 bits (58), Expect = 6.9 Identities = 24/107 (22%), Positives = 42/107 (39%), Gaps = 3/107 (2%) Frame = +2 Query: 200 SVKAGHSIDVVISGKTPEDKMAGILLEARQGDKIVGTWTVSPDDTFSQPLNCGEPNNAVT 379 ++++ I VV+ K E + G + + VSP F L +PN+ + Sbjct: 43 TIESTDPILVVVEEKLLEKSVDGEKEDDNSSSSNMEIDPVSPATVFCVKLK--QPNSNLL 100 Query: 380 HKMHAKELDRQTVSYPWTAPKD---LEGDVVFKVTIVKSYAVFWVGI 511 HKM EL R + W + + ++ K+ FW+ I Sbjct: 101 HKMSVPELCRNFSAVAWCGKLNAIACASETCARIPSSKANTPFWIPI 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,878,298 Number of Sequences: 28952 Number of extensions: 312417 Number of successful extensions: 777 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -