BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_D03 (393 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 22 7.0 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 22 7.0 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 22 7.0 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 22.2 bits (45), Expect = 7.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +3 Query: 195 DFVEGNMDNWLKF 233 DF+ G+ DNW F Sbjct: 1051 DFLMGSQDNWSSF 1063 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 22.2 bits (45), Expect = 7.0 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +2 Query: 32 VVRYGPGCIYSDQRRNTRTNLLEAFRDYTVDENDPIKMRVRDNHIMI 172 V+ Y G IY + T LE+FR ++D K + IMI Sbjct: 227 VILYCYGSIYYEIFSRTNPRNLESFRRSSIDVLGRAKRKTLRMTIMI 273 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 22.2 bits (45), Expect = 7.0 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +2 Query: 32 VVRYGPGCIYSDQRRNTRTNLLEAFRDYTVDENDPIKMRVRDNHIMI 172 V+ Y G IY + T LE+FR ++D K + IMI Sbjct: 227 VILYCYGSIYYEIFSRTNPRNLESFRRSSIDVLGRAKRKTLRMTIMI 273 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 450,921 Number of Sequences: 2352 Number of extensions: 9372 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30784536 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -