BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C23 (480 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharom... 25 4.5 SPAC328.03 |tps1||alpha,alpha-trehalose-phosphate synthase [UDP-... 25 5.9 SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2... 25 7.8 >SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 326 Score = 25.4 bits (53), Expect = 4.5 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -1 Query: 336 LLDPARIPDYRLQILPGHVRIPDYRHQILPDLVQIPDYHLQILPDP 199 L DP +I + P H+ P R+ LP + DY+ I+ P Sbjct: 5 LKDPVKIFEINKGKRPVHIAAPMVRYSKLPFRQLVRDYNTDIVYTP 50 >SPAC328.03 |tps1||alpha,alpha-trehalose-phosphate synthase [UDP-forming]|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 25.0 bits (52), Expect = 5.9 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 246 DLVQIPDYHLQILP 205 DL+ + DYHL +LP Sbjct: 152 DLIWVQDYHLMVLP 165 >SPBC1198.08 |||dipeptidase Dug1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 474 Score = 24.6 bits (51), Expect = 7.8 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = -1 Query: 318 IPDYRLQILPGHVRIPDYRHQILPDLVQIPDYHLQILPDPDQNLDHR 178 I D ++ P I D + DL + + I PDP + L HR Sbjct: 261 IMDQVAELTPTEDSIYDGIDYTMEDLKEAVGADISIYPDPKRTLQHR 307 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,179,922 Number of Sequences: 5004 Number of extensions: 18284 Number of successful extensions: 52 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 184020746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -