BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C23 (480 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 26 0.18 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 3.0 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 26.2 bits (55), Expect = 0.18 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +1 Query: 271 RDTDMAREDLEAVIR 315 RDTD++R DLEA +R Sbjct: 306 RDTDLSRADLEATLR 320 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 3.0 Identities = 14/54 (25%), Positives = 23/54 (42%) Frame = -1 Query: 270 DYRHQILPDLVQIPDYHLQILPDPDQNLDHRCPGHRVLV*NLGCYLQIHPGLVH 109 D+RH P+LV++ D + P L H P ++ +H G +H Sbjct: 861 DWRHWKFPNLVEVLDEFPSVRPFAPLLLLHLTPLQPRFY-SISSSPDVHQGQIH 913 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,799 Number of Sequences: 438 Number of extensions: 1455 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -