BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C22 (545 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 25 2.2 AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. 24 2.8 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 3.8 AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 23 6.6 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 8.7 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.6 bits (51), Expect = 2.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 149 RLEDLHQLQRPYAFHRRYGACAHPPLQ 69 R+E + +L AF R +GA + PP + Sbjct: 846 RIESIQRLFTRVAFRRLFGAASLPPYE 872 >AJ302657-1|CAC35522.1| 115|Anopheles gambiae gSG6 protein protein. Length = 115 Score = 24.2 bits (50), Expect = 2.8 Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Frame = +1 Query: 157 ERLCSPC-------CRR*RQAGLPYETGSPD*QPCTSLDVKGHSSCYRPRRD 291 ER C+ C C+ R+ LPY P +PC S D G SC + D Sbjct: 54 ERFCTLCDTRHFCECKETREP-LPYMYACPGTEPCQSSDRLG--SCSKSMHD 102 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 3.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +2 Query: 113 RMGAEVDADLLGDEWKGYVLRVAGGNDKQG 202 R E A L+ WK Y R GG D G Sbjct: 1988 RQREEYCARLIQHAWKRYKQRHGGGTDASG 2017 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.0 bits (47), Expect = 6.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 384 GAQEIPGLTDGEVPRRLGPKRASKIRKLFTLKK 482 GAQ++ G G P + PK IR T K Sbjct: 202 GAQKVLGAPPGITPISISPKALDVIRNRRTKSK 234 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 22.6 bits (46), Expect = 8.7 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -2 Query: 400 GISCAPLRDND 368 G+SCA L DND Sbjct: 727 GLSCADLEDND 737 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 563,546 Number of Sequences: 2352 Number of extensions: 10966 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -