BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C21 (127 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 0.41 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 23 0.96 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 21 3.9 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 21 3.9 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 21 3.9 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 21 3.9 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 21 5.1 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 21 5.1 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 21 5.1 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 21 5.1 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 21 5.1 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 21 5.1 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 21 5.1 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 21 5.1 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 21 5.1 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 21 5.1 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 21 5.1 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 21 5.1 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 21 5.1 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 21 6.8 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 0.41 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -2 Query: 99 TIVHHVNSVCGSHGQYGEEEKHESFHCRIVSEL 1 +I H + +CG + +EK E+F ++ L Sbjct: 2732 SISHGLEQICGGSADFPSQEKAENFLMHLLMPL 2764 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 23.4 bits (48), Expect = 0.96 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 9 TLFDNESFRVFLLRRIGHGCRKQSS 83 TLFD E F VF + G KQS+ Sbjct: 319 TLFDREGFAVFRDHKSMLGALKQST 343 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 21.4 bits (43), Expect = 3.9 Identities = 8/24 (33%), Positives = 10/24 (41%) Frame = +3 Query: 42 LLRRIGHGCRKQSSRGGQ*WCSIG 113 L+ HGC GG C +G Sbjct: 112 LVPEYSHGCMSPEQGGGLLQCKVG 135 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 21.4 bits (43), Expect = 3.9 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 3 TLTLFDNESFRVFLLRRIGHG 65 +L +F+N+ F L + + HG Sbjct: 388 SLKIFNNQEFAQLLSQSVNHG 408 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 21.4 bits (43), Expect = 3.9 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -2 Query: 90 HHVNSVCGSHGQYGEEEKHES 28 HHV+ + HG Y + H + Sbjct: 42 HHVHMMPEMHGAYSQVHHHRA 62 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 21.4 bits (43), Expect = 3.9 Identities = 7/21 (33%), Positives = 11/21 (52%) Frame = -2 Query: 90 HHVNSVCGSHGQYGEEEKHES 28 HHV+ + HG Y + H + Sbjct: 42 HHVHMMPEMHGAYSQVHHHRA 62 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 Score = 20.6 bits (41), Expect = 6.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 186 HYSAPIAHHAAP 197 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 196 HYAAPIAHHAAP 207 Score = 20.6 bits (41), Expect = 6.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 182 HYSAPIAHHAAP 193 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 Score = 20.6 bits (41), Expect = 6.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 194 HYSAPIAHHAAP 205 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 Score = 20.6 bits (41), Expect = 6.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 194 HYSAPIAHHAAP 205 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 232 HYAAPIAHHAAP 243 Score = 20.6 bits (41), Expect = 6.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 218 HYSAPIAHHAAP 229 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 186 HYAAPIAHHAAP 197 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 194 HYAAPIAHHAAP 205 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 Score = 20.6 bits (41), Expect = 6.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 186 HYSAPIAHHAAP 197 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 208 HYAAPIAHHAAP 219 Score = 20.6 bits (41), Expect = 6.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 194 HYSAPIAHHAAP 205 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 21.0 bits (42), Expect = 5.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 200 HYAAPIAHHAAP 211 Score = 20.6 bits (41), Expect = 6.8 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = -1 Query: 124 HYCRPMEHHYCP 89 HY P+ HH P Sbjct: 186 HYSAPIAHHAAP 197 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 20.6 bits (41), Expect = 6.8 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = -1 Query: 124 HYCRPMEHHY 95 +YCR + HH+ Sbjct: 167 YYCRNISHHF 176 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,089 Number of Sequences: 2352 Number of extensions: 1463 Number of successful extensions: 31 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 22 effective length of database: 512,235 effective search space used: 9732465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -