BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C20 (576 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0604 - 16132173-16132391,16132488-16132556,16132824-161328... 31 0.66 10_07_0045 + 12328388-12328419,12328504-12328645,12328862-123290... 29 3.5 05_06_0202 - 26339467-26339494,26339579-26339624,26339742-263397... 28 4.6 12_02_0503 - 19756561-19757991,19758606-19759967 28 6.1 03_05_0006 + 19527479-19528769,19529693-19530105,19530220-195304... 27 8.1 >05_03_0604 - 16132173-16132391,16132488-16132556,16132824-16132898, 16132981-16133113,16133188-16133297,16133360-16133407, 16133657-16133983,16135006-16135233,16135360-16135689, 16135780-16136586 Length = 781 Score = 31.1 bits (67), Expect = 0.66 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +2 Query: 188 EKNRVYIKILNIHRNQYLKLEIKSDVDGDHKAFGADADDTYRHQW 322 + +R YI IL HRN+ LK+E+ D G +++ W Sbjct: 61 DNSRHYIVILGSHRNKRLKIEVDGKTVVDVAGIGLCCSSSFQSYW 105 >10_07_0045 + 12328388-12328419,12328504-12328645,12328862-12329054, 12329224-12329320,12329404-12329528,12329616-12329734, 12331225-12331298,12331359-12331413,12331450-12331500, 12331611-12331857,12331940-12332036,12332170-12332244, 12334286-12334488,12334757-12334905,12334995-12335168, 12335276-12335401,12335493-12335623,12335743-12335818, 12335898-12336027,12336115-12336193,12336267-12336465, 12336591-12336698,12336769-12337025,12337267-12337282 Length = 984 Score = 28.7 bits (61), Expect = 3.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -3 Query: 121 PVSVIVHTQLKLKSQFISLVNN 56 P +IVH + K++SQF ++NN Sbjct: 93 PTEMIVHLRFKIRSQFCMILNN 114 >05_06_0202 - 26339467-26339494,26339579-26339624,26339742-26339785, 26340729-26340851,26341010-26341124,26341447-26342207, 26342305-26342711,26342798-26342900,26344642-26345144 Length = 709 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/63 (23%), Positives = 30/63 (47%) Frame = +2 Query: 251 IKSDVDGDHKAFGADADDTYRHQWYLHPVLLEKETLFYIYNRRYNKPLKLGRHVDSDGDR 430 +K + +G+ A A+ ++ + P + FY+++ R+ + GR GDR Sbjct: 118 MKGEAEGEASAAAAEGEEGKKGS---EPYAVPTAGAFYMHDDRFQEARGHGRQRRMVGDR 174 Query: 431 QLW 439 +LW Sbjct: 175 RLW 177 >12_02_0503 - 19756561-19757991,19758606-19759967 Length = 930 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = -2 Query: 488 QCAIRNVQDCRRLHYVPTVVYRHHCRRAFQVSKVYCTVCCRYKIAFP 348 Q +I NV+ C L + + HCR V V VCC I+ P Sbjct: 694 QLSILNVESCNLLVSLNGFLQEEHCR----VLTVLSLVCCHMLISLP 736 >03_05_0006 + 19527479-19528769,19529693-19530105,19530220-19530430, 19530531-19530768,19530847-19530997,19531240-19531542 Length = 868 Score = 27.5 bits (58), Expect = 8.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +2 Query: 107 NDGDRASFGDGADKTSHRVSWRIYPLWEKNRV 202 N+G FG S +W I P W++N V Sbjct: 481 NNGQVTPFGQRNHTASALNNWEITPFWQRNHV 512 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,175,842 Number of Sequences: 37544 Number of extensions: 311977 Number of successful extensions: 770 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 752 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 770 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1340735508 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -