BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C19 (472 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 112 2e-25 SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) 31 0.64 SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_37670| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_58727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_41944| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 27 7.8 SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 112 bits (269), Expect = 2e-25 Identities = 54/104 (51%), Positives = 70/104 (67%) Frame = +1 Query: 85 EDSKKLPAVPESVXXXXXXXXXXXXXXXQITLKRRSASIKKRKEIFKRAEQYVKEYRIKE 264 +D K+P VPE++ + L ++ KRKEIFKRAE+YVKEYR KE Sbjct: 3 QDRVKVPRVPETLLKKRKSLEQIKAARAKAQLAQKKLQHGKRKEIFKRAEKYVKEYRQKE 62 Query: 265 RDEIRLARQARNRGNYYVPGEAKLAFVIRIRGVNQVSPKVRKVL 396 DE+R+ + A+ GN+YVP EA+LAFVIRIRG+N VSPKVRK+L Sbjct: 63 VDELRMKKMAKKHGNFYVPPEARLAFVIRIRGINGVSPKVRKIL 106 Score = 44.4 bits (100), Expect = 5e-05 Identities = 20/27 (74%), Positives = 22/27 (81%) Frame = +2 Query: 377 PRYARYCQLFRLRQINNGVFVRLNKAT 457 P+ + QL RLRQINNGVFVRLNKAT Sbjct: 100 PKVRKILQLLRLRQINNGVFVRLNKAT 126 >SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) Length = 712 Score = 30.7 bits (66), Expect = 0.64 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +1 Query: 259 KERDEIRLARQARNRGNYYVPGEAKLAFVIRIRGVNQVSPKVRKVLP 399 K RD +AR+ R+RG YY+P + + +P+ R LP Sbjct: 483 KIRDTSSIARETRSRGPYYLPEVEVDQAEVHVPSGTSKTPRYRPTLP 529 >SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 187 RSASIKKRKEIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 312 R + +R+EI++R E Y + + R+ RL R R Y Sbjct: 27 RRREMYRRREIYRRREMYRRREMYRRREMYRLREMYRRREMY 68 >SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1981 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 277 RLARQARNRGNYYVPGEAKLAFVIRIRGVNQVSPKVRK 390 RL R + R NYY+ + +AF + I V + P R+ Sbjct: 1886 RLRRTEKRRQNYYIATQKLMAFALNIYEVLKDDPLTRR 1923 >SB_37670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 27.9 bits (59), Expect = 4.5 Identities = 9/36 (25%), Positives = 22/36 (61%) Frame = +1 Query: 190 SASIKKRKEIFKRAEQYVKEYRIKERDEIRLARQAR 297 S +KRK +FK ++ K+ ++++ D +++ Q + Sbjct: 802 STETRKRKHVFKSGDRTAKKRKLEDNDHEKISTQVK 837 >SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +1 Query: 187 RSASIKKRKEIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 312 R +I +R+E+++R E Y + + R+ R R R Y Sbjct: 16 RRRAINRRREMYRRREMYRRREMYRRREMYRRREMYRRREMY 57 >SB_58727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.1 bits (57), Expect = 7.8 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -2 Query: 306 ATVTSLSCQSDF-ITLLDAVFFDILFGSLKD 217 ATV+ S + F T L V+FD F SLKD Sbjct: 6 ATVSGRSMRLSFGATALSGVWFDFYFSSLKD 36 >SB_41944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 27.1 bits (57), Expect = 7.8 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = -3 Query: 392 TLRTLGDTWLTPRIRMTNASLASPGT**LPRLRACLANLISSRSLMRYSLTYCS 231 TL +L D + PR+ + SL PG +PRL L +L + R L S Sbjct: 467 TLLSLTDPGVIPRLLLALLSLTDPGV--IPRLLLALLSLTHPEVIPRLLLALLS 518 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 27.1 bits (57), Expect = 7.8 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = +1 Query: 202 KKRKEIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKL 336 KK KE+ + Q ++ + + D RLA + R R +P + ++ Sbjct: 967 KKAKELVSKQRQISTKFELMDNDLYRLAEKLRERKRLGLPEQEEV 1011 >SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 27.1 bits (57), Expect = 7.8 Identities = 14/53 (26%), Positives = 29/53 (54%) Frame = +1 Query: 178 LKRRSASIKKRKEIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKL 336 ++R ++R+E +R + +E R++ DE+R R+ +RG + E +L Sbjct: 1148 MRREEKDARRREEEERRLRE--EEDRLRREDELRRKREDDDRGRRKLAEERRL 1198 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,703,942 Number of Sequences: 59808 Number of extensions: 294511 Number of successful extensions: 868 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 867 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -