Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0006_C19
         (472 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF487781-1|AAL96668.1|  533|Anopheles gambiae cytochrome P450 CY...    24   3.1  
AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase ...    23   4.1  

>AF487781-1|AAL96668.1|  533|Anopheles gambiae cytochrome P450
           CYP9L1 protein protein.
          Length = 533

 Score = 23.8 bits (49), Expect = 3.1
 Identities = 14/40 (35%), Positives = 22/40 (55%)
 Frame = +1

Query: 214 EIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAK 333
           E+F+++ Q  +E+ I   D I L  QAR     Y P E++
Sbjct: 255 EMFRQSVQEREEHGIVRPDLIHLLIQARKGQLRYQPQESE 294


>AJ439060-7|CAD27758.1|  849|Anopheles gambiae putative V-ATPase
           protein.
          Length = 849

 Score = 23.4 bits (48), Expect = 4.1
 Identities = 6/12 (50%), Positives = 11/12 (91%)
 Frame = -1

Query: 400 LAIPCVPWVILG 365
           +A+ C+PW++LG
Sbjct: 648 IALLCIPWMLLG 659


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 481,889
Number of Sequences: 2352
Number of extensions: 9312
Number of successful extensions: 9
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 41245467
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)