BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C17 (353 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0568 + 22351552-22351679,22352176-22352227,22353044-223531... 32 0.11 05_05_0353 - 24338717-24338946,24339046-24339134,24339421-243395... 32 0.11 01_01_0144 - 1316626-1316658,1317580-1318863 32 0.15 07_03_1390 + 26217623-26218370,26218435-26218934 31 0.26 01_01_0119 + 1102872-1104170,1105419-1105516,1105849-1106206 31 0.34 02_05_1059 + 33815979-33816235,33816467-33816732,33817149-338171... 29 0.79 10_08_0422 - 17796916-17797167,17797328-17797453,17797546-177977... 28 2.4 12_01_1041 - 10711362-10711428,10711571-10712262,10712622-107127... 27 5.6 02_04_0276 + 21491150-21492761,21492891-21492947,21493817-214938... 27 5.6 05_01_0515 + 4343067-4344206,4344293-4344478,4344884-4345018,434... 26 7.4 01_05_0195 - 19111983-19112477,19112646-19113950,19114053-191143... 26 7.4 03_02_0870 + 11964135-11964224,11965013-11965175,11965262-119653... 26 9.8 >06_03_0568 + 22351552-22351679,22352176-22352227,22353044-22353117, 22353233-22353322,22353833-22353976,22354885-22354973, 22355539-22355612,22357233-22357317,22357677-22357952, 22358392-22358420 Length = 346 Score = 32.3 bits (70), Expect = 0.11 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 153 WSIENNINHYKNETAVKIWILMKKQNWL 236 W + I+ Y N TA+ W++ K+ NW+ Sbjct: 44 WLVATLIDFYVNVTAISTWVIYKEVNWI 71 >05_05_0353 - 24338717-24338946,24339046-24339134,24339421-24339500, 24339768-24339902,24340231-24340461,24340540-24340634, 24340734-24340819,24341467-24341570,24341674-24341805, 24341883-24341999,24342170-24342229,24342779-24342820, 24342878-24342952,24343127-24343177,24343256-24343436, 24343548-24343594,24343710-24343775 Length = 606 Score = 32.3 bits (70), Expect = 0.11 Identities = 18/66 (27%), Positives = 35/66 (53%) Frame = +3 Query: 96 YFHAREPNHVSKSITISASWSIENNINHYKNETAVKIWILMKKQNWLLPLSVPFSPLNPT 275 Y + EP ++KS T A + +N+N N + + ++ ++ + LL + PF L+P Sbjct: 230 YAESTEPPMLAKSATRIAILGV-SNLNS-SNTRCINVSLMQQRGDSLLIMGSPFGILSPV 287 Query: 276 HQFEAV 293 H F ++ Sbjct: 288 HFFNSI 293 >01_01_0144 - 1316626-1316658,1317580-1318863 Length = 438 Score = 31.9 bits (69), Expect = 0.15 Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +3 Query: 150 SWSIENNINHYKNETAV---KIWILMKKQNWLLPLSVPFSPLNPTHQFEAVIMFNVLYSA 320 +WS+ + H+K ET + IW LP +PFSPL + E IM+ VL Sbjct: 303 TWSLSPDFKHWKEETTLTVGDIWASESFNQMGLPHVLPFSPLLGVN--EDGIMYAVLNHV 360 Query: 321 KD 326 K+ Sbjct: 361 KE 362 >07_03_1390 + 26217623-26218370,26218435-26218934 Length = 415 Score = 31.1 bits (67), Expect = 0.26 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%) Frame = +3 Query: 30 CDPVRTDDSVEFAKKQIDISLLYFHA--REPNHVSKSITISASWSIEN 167 C PV D + K+Q+ + LL + ++P+ SKS++ +A W +EN Sbjct: 303 CMPVHAD--IIILKEQMRMQLLEYKLLRKKPSQDSKSVSTNADWKLEN 348 >01_01_0119 + 1102872-1104170,1105419-1105516,1105849-1106206 Length = 584 Score = 30.7 bits (66), Expect = 0.34 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = +3 Query: 150 SWSIENNINHYKNETAV---KIWILMKKQNWLLPLSVPFSPLNPTHQFEAVIMFNVLYSA 320 +WS+ + H+K ET + IW LP +PFSP+ + E IM+ VL Sbjct: 308 TWSLSPDFKHWKEETTLTVGDIWASESFNQMGLPHVLPFSPVLSVN--EDGIMYAVLNDV 365 Query: 321 K 323 K Sbjct: 366 K 366 >02_05_1059 + 33815979-33816235,33816467-33816732,33817149-33817192, 33817363-33817539,33817638-33817964,33818067-33818192, 33818518-33818622,33818815-33820125,33820221-33820382, 33820416-33820517,33820549-33821272,33821358-33821451, 33821824-33821986 Length = 1285 Score = 29.5 bits (63), Expect = 0.79 Identities = 14/55 (25%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +3 Query: 168 NINHYKNETAVKIWILMKKQNWLLPLSVP-FSPLNPTHQFEAVIMFNVLYSAKDY 329 N H + + K +++K +L + + FSP NP H+ + + F + K Y Sbjct: 298 NCEHCRQKVVAKKRFMIEKAPSVLTIHLKRFSPFNPRHKIDKKVQFQPTLNLKPY 352 >10_08_0422 - 17796916-17797167,17797328-17797453,17797546-17797700, 17797793-17797907,17798022-17798118,17798274-17798368, 17798500-17798585,17798689-17798819,17798909-17799090 Length = 412 Score = 27.9 bits (59), Expect = 2.4 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 106 AWKYNKEISICFFANSTESSVLTGSHNPGAKM 11 +W N++ + F N T++ VL HNP K+ Sbjct: 142 SWTLNEDKFLKSFTNRTKAVVLNSPHNPTGKV 173 >12_01_1041 - 10711362-10711428,10711571-10712262,10712622-10712777, 10712885-10713957,10714422-10714524,10714694-10714876, 10715007-10715099,10715379-10715564,10716530-10716793 Length = 938 Score = 26.6 bits (56), Expect = 5.6 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 117 NHVSKSITISASWSIENNINHY 182 NHVS+ I S W + NN + Y Sbjct: 770 NHVSEQIQTSLPWDVHNNQHGY 791 >02_04_0276 + 21491150-21492761,21492891-21492947,21493817-21493870, 21493994-21494022 Length = 583 Score = 26.6 bits (56), Expect = 5.6 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +3 Query: 24 GLCDPVRTDDSVEFAKKQIDISLLYFHAREPNHVSKSITISASWSIE 164 G+C R DD++EF K L + EPN VS +I + + E Sbjct: 237 GICQEGRVDDAIEFLKN------LPSYGCEPNTVSYNIVLKGLCTAE 277 >05_01_0515 + 4343067-4344206,4344293-4344478,4344884-4345018, 4346652-4346753,4346973-4347068,4347146-4347238, 4347351-4347470,4347580-4347612,4347699-4347749, 4347874-4347952,4348398-4348456 Length = 697 Score = 26.2 bits (55), Expect = 7.4 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 4/31 (12%) Frame = +3 Query: 153 WSIENNINHYKNETAV--KIW--ILMKKQNW 233 WSI+ + NHYK+ V KIW + +K N+ Sbjct: 557 WSIQFDFNHYKDFDGVYFKIWKRVAKRKMNF 587 >01_05_0195 - 19111983-19112477,19112646-19113950,19114053-19114322, 19118884-19118950,19119229-19119284,19119530-19119590, 19120181-19120297,19120570-19120682,19120774-19120848, 19121464-19122045,19122056-19122271,19122372-19122497, 19126152-19126190,19126266-19126360,19126423-19126962, 19127102-19127327,19127385-19127437,19127534-19127701, 19128353-19128707,19128785-19128876,19129891-19129993 Length = 1717 Score = 26.2 bits (55), Expect = 7.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -2 Query: 103 WKYNKEISICFFANSTESSVL 41 W YN++ CF + STE VL Sbjct: 139 WMYNRKTWTCFLSYSTELEVL 159 >03_02_0870 + 11964135-11964224,11965013-11965175,11965262-11965380, 11965971-11966083,11966179-11966234,11966320-11966417, 11966588-11966725,11966820-11967125,11967208-11967471, 11967587-11967754,11967838-11968056,11968115-11968158, 11968761-11968830,11968949-11969110,11969672-11969779, 11969873-11969910,11970121-11970265,11970800-11970926, 11971037-11971230,11971529-11971659,11972014-11972089, 11972218-11972328,11972465-11972647,11973264-11973407, 11973946-11973969,11974555-11974728,11974808-11975155, 11975232-11975561,11975776-11975961,11976052-11977026, 11977145-11977399 Length = 1852 Score = 25.8 bits (54), Expect = 9.8 Identities = 11/47 (23%), Positives = 22/47 (46%) Frame = +3 Query: 72 KQIDISLLYFHAREPNHVSKSITISASWSIENNINHYKNETAVKIWI 212 KQI LL + + K + + N+ N++KN T +++ + Sbjct: 1241 KQIAFHLLRLAVFRNDSIRKRAVVGLQILVRNSFNYFKNTTRLRVML 1287 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,495,210 Number of Sequences: 37544 Number of extensions: 148530 Number of successful extensions: 359 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 359 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 530315984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -