BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C17 (353 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54782| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.4 SB_56576| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.8 >SB_54782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 27.1 bits (57), Expect = 4.4 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 335 CVVVFSGIQDIEHYDSFKL 279 C VVFSGIQ + YD +K+ Sbjct: 409 CGVVFSGIQIAKEYDFYKM 427 >SB_56576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 658 Score = 26.6 bits (56), Expect = 5.8 Identities = 19/54 (35%), Positives = 23/54 (42%) Frame = +3 Query: 39 VRTDDSVEFAKKQIDISLLYFHAREPNHVSKSITISASWSIENNINHYKNETAV 200 V TD FA KQ L++ N V+ S I ASW + NH T V Sbjct: 327 VSTDPRFYFAWKQ-SFGGLFYQFIGQNIVASSNKIGASWGVIMPKNHLHTSTNV 379 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,310,822 Number of Sequences: 59808 Number of extensions: 179623 Number of successful extensions: 441 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 441 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 548040812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -