BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C16 (582 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 25 0.54 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 8.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 8.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 8.9 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 25.0 bits (52), Expect = 0.54 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = -2 Query: 440 MWCSHSELADGRRGFAAENTDRAREYKPQVRRLTSGCLEQRPRRVEVNAQPE 285 M+ S E R+ + + + EYKP++ EQR ++VE++ E Sbjct: 147 MYSSGGEEITPRQSHQSYHHMDSVEYKPEIMEYKPDVEEQRYKQVEISQMTE 198 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = -2 Query: 581 ERRHCQVGRAAAHAHCGQAHSASVCPASTR 492 E++ C H +HS CPA ++ Sbjct: 258 EKQECTECPIGKFKHEAGSHSCEACPAHSK 287 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 8.9 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -2 Query: 344 LTSGCLEQRPRRVEVNAQPEIKVDLCVTAHN 252 L S ++ + R V N QP L V HN Sbjct: 1546 LVSNSVKMQRRFVVTNLQPSSVYQLKVETHN 1576 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.0 bits (42), Expect = 8.9 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -2 Query: 344 LTSGCLEQRPRRVEVNAQPEIKVDLCVTAHN 252 L S ++ + R V N QP L V HN Sbjct: 1542 LVSNSVKMQRRFVVTNLQPSSVYQLKVETHN 1572 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,785 Number of Sequences: 438 Number of extensions: 2025 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16870914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -