BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C11 (440 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 24 0.65 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 1.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 1.5 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 2.6 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 22 3.4 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 24.2 bits (50), Expect = 0.65 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 174 NDGNLAYSVNDLGYKILIQKMQQNKNENIVIS 269 ND AY ++LGY +++ +QN++ I S Sbjct: 203 NDA-FAYMSDELGYGLIVYSWEQNRSWRITHS 233 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 1.5 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = +3 Query: 111 LNWSSGNSHETNDEKVTTSIINDGNL 188 ++WS+ + H ND ++ +G L Sbjct: 62 IDWSTADGHPVNDVPGVRRVLRNGTL 87 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 1.5 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = +3 Query: 111 LNWSSGNSHETNDEKVTTSIINDGNL 188 ++WS+ + H ND ++ +G L Sbjct: 62 IDWSTADGHPVNDVPGVRRVLRNGTL 87 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 120 SSGNSHETNDEKVTTSI 170 SS +S E+ +EK TTS+ Sbjct: 756 SSTSSEESREEKATTSL 772 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.8 bits (44), Expect = 3.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 388 PRSISANYTNLNTDLCR 438 PRSI+ N T L LCR Sbjct: 587 PRSITRNATALIKKLCR 603 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,322 Number of Sequences: 438 Number of extensions: 2045 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -