BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C10 (664 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1BY90 Cluster: Coat protein; n=5; Cowpea mild mottle v... 35 1.5 UniRef50_Q6YI20 Cluster: HsPet8; n=4; Ascomycota|Rep: HsPet8 - E... 33 6.1 UniRef50_Q0UY39 Cluster: Predicted protein; n=1; Phaeosphaeria n... 33 6.1 >UniRef50_A1BY90 Cluster: Coat protein; n=5; Cowpea mild mottle virus|Rep: Coat protein - Cowpea mild mottle virus Length = 288 Score = 35.1 bits (77), Expect = 1.5 Identities = 21/53 (39%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -1 Query: 463 TQDW-GELRIPSSVVFRLRRQISTLLRLGYLYEDISWNFFCTDCQQPIVTSEW 308 T DW G + SV+ LR+ +TL R+ LY I+WNF T P S+W Sbjct: 153 TFDWKGGSILSDSVIAALRKDDNTLRRVCRLYAPITWNFMLTHKAPP---SDW 202 >UniRef50_Q6YI20 Cluster: HsPet8; n=4; Ascomycota|Rep: HsPet8 - Eremothecium sinecaudum Length = 224 Score = 33.1 bits (72), Expect = 6.1 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = +2 Query: 134 CKMAVPTVTLNELSDATQDNTINPSPKKVLKNPERLHGPAIRKGNTVHYWQQVVLRELPF 313 C + VP + + TQ + N S K + P +G IR+ N W ++RE+PF Sbjct: 74 CLVRVPAEVVKQ---RTQTHKSNSSIKTLQALPRNENGEGIRR-NLYRGWWTTIMREIPF 129 Query: 314 RC 319 C Sbjct: 130 TC 131 >UniRef50_Q0UY39 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 186 Score = 33.1 bits (72), Expect = 6.1 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +1 Query: 193 HHQPKP*EGSKES*TTTWTCNTERKHRTLLAASRPSGATIQMSRSVA 333 H P P + ++++T E HR L AA+ PSG T ++RS A Sbjct: 83 HPAPTPASALAAAQSSSFTWGHEPDHRPLTAAALPSGPTFTLNRSAA 129 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 601,553,062 Number of Sequences: 1657284 Number of extensions: 11404429 Number of successful extensions: 29339 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29332 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 50413227838 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -