BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C10 (664 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0442 + 3134715-3135203,3135631-3135966 28 5.8 07_01_0641 - 4790704-4790720,4790824-4791296,4791707-4792023,479... 28 7.6 >06_01_0442 + 3134715-3135203,3135631-3135966 Length = 274 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 472 NFKTQDWGELRIPSSVVFRLRRQISTLLRL 383 NF+ +DW L VF LR ++++ LR+ Sbjct: 182 NFRREDWRSLLFHGRSVFHLRNRLASQLRI 211 >07_01_0641 - 4790704-4790720,4790824-4791296,4791707-4792023, 4792094-4792423 Length = 378 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +2 Query: 92 RNHCPFLISLLNKHCKMAVP-TVTLNELSDATQDNTINPS 208 ++HC L+ LL + C++ VP V NE D T +P+ Sbjct: 92 KDHCNGLLLLLREECRLVVPWAVDCNENEYLVFDPTRSPN 131 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,063,496 Number of Sequences: 37544 Number of extensions: 309199 Number of successful extensions: 868 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -