BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C09 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 3.8 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 28 4.4 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 28 4.4 SB_6817| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 26.2 bits (55), Expect(2) = 3.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -1 Query: 58 NDRLAPPPPRAGAYSSY 8 ND PPPPR G Y Y Sbjct: 61 NDIPPPPPPRRGFYDDY 77 Score = 20.6 bits (41), Expect(2) = 3.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 67 PRANDRLAPPPP 32 PR +R PPPP Sbjct: 44 PRDRERPPPPPP 55 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 41 GGKPVIRPGRQNLEAEGGPRGP 106 GG P +RP + A GPRGP Sbjct: 100 GGMPKLRPAGERKAAGAGPRGP 121 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 41 GGKPVIRPGRQNLEAEGGPRGP 106 GG P +RP + A GPRGP Sbjct: 12 GGMPKLRPAGERKAAGAGPRGP 33 >SB_6817| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -1 Query: 145 NKYQFTISMFTSKRAAGPPLRLQV--LAPRANDRLAPPPPR 29 N Y FT++ F +K P R V + +R PPPP+ Sbjct: 7 NNYTFTLTAFMTKIICAPSRRAAVENIIKAYGERHPPPPPQ 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,654,968 Number of Sequences: 59808 Number of extensions: 281172 Number of successful extensions: 773 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -