BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C09 (550 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK125806-1|BAC86301.1| 152|Homo sapiens protein ( Homo sapiens ... 31 2.0 BC142689-1|AAI42690.1| 1024|Homo sapiens PSD protein protein. 31 2.7 BC142643-1|AAI42644.1| 1024|Homo sapiens PSD protein protein. 31 2.7 AL121928-3|CAI12516.1| 1024|Homo sapiens pleckstrin and Sec7 dom... 31 2.7 AB095931-1|BAC23107.1| 1091|Homo sapiens KIAA2011 protein protein. 31 2.7 AY358128-1|AAQ88495.1| 717|Homo sapiens IGSF9 protein. 31 3.5 AL513485-4|CAI14605.1| 1179|Homo sapiens immunoglobulin superfam... 31 3.5 AB065820-1|BAC06039.1| 319|Homo sapiens seven transmembrane hel... 31 3.5 AB037776-1|BAA92593.1| 1189|Homo sapiens KIAA1355 protein protein. 31 3.5 AB065819-1|BAC06038.1| 329|Homo sapiens seven transmembrane hel... 30 4.6 >AK125806-1|BAC86301.1| 152|Homo sapiens protein ( Homo sapiens cDNA FLJ43818 fis, clone TESTI4001923. ). Length = 152 Score = 31.5 bits (68), Expect = 2.0 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 2 FVITRISACSGRGGGKPVIRPGRQNLEAEGGPR 100 F++ R++ GRG G+P+ R G + EA G PR Sbjct: 28 FLLERVTGTKGRGQGQPLERAGEEG-EAGGDPR 59 >BC142689-1|AAI42690.1| 1024|Homo sapiens PSD protein protein. Length = 1024 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 120 CLQANGPRGPPSASKFWRPGRMTGLPPPLPEQALIL 13 C GP P A W P TG PPP + ++++ Sbjct: 67 CTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVI 102 >BC142643-1|AAI42644.1| 1024|Homo sapiens PSD protein protein. Length = 1024 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 120 CLQANGPRGPPSASKFWRPGRMTGLPPPLPEQALIL 13 C GP P A W P TG PPP + ++++ Sbjct: 67 CTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVI 102 >AL121928-3|CAI12516.1| 1024|Homo sapiens pleckstrin and Sec7 domain containing protein. Length = 1024 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 120 CLQANGPRGPPSASKFWRPGRMTGLPPPLPEQALIL 13 C GP P A W P TG PPP + ++++ Sbjct: 67 CTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVI 102 >AB095931-1|BAC23107.1| 1091|Homo sapiens KIAA2011 protein protein. Length = 1091 Score = 31.1 bits (67), Expect = 2.7 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = -2 Query: 120 CLQANGPRGPPSASKFWRPGRMTGLPPPLPEQALIL 13 C GP P A W P TG PPP + ++++ Sbjct: 134 CTPLRGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVI 169 >AY358128-1|AAQ88495.1| 717|Homo sapiens IGSF9 protein. Length = 717 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -2 Query: 126 YQCLQANGPRGPPSASKFWR---PGRMTGLPPPLP 31 Y C+ +NG PPSAS + P ++T +PP P Sbjct: 299 YTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETP 333 >AL513485-4|CAI14605.1| 1179|Homo sapiens immunoglobulin superfamily, member 9 protein. Length = 1179 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -2 Query: 126 YQCLQANGPRGPPSASKFWR---PGRMTGLPPPLP 31 Y C+ +NG PPSAS + P ++T +PP P Sbjct: 299 YTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETP 333 >AB065820-1|BAC06039.1| 319|Homo sapiens seven transmembrane helix receptor protein. Length = 319 Score = 30.7 bits (66), Expect = 3.5 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 527 PSLHQALLVMLCILAAFSLAITSSRTKRQVA 435 PSLHQ++ + L +LAA L + SS + +A Sbjct: 71 PSLHQSMYLFLSMLAAIDLVVASSTAPKALA 101 >AB037776-1|BAA92593.1| 1189|Homo sapiens KIAA1355 protein protein. Length = 1189 Score = 30.7 bits (66), Expect = 3.5 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -2 Query: 126 YQCLQANGPRGPPSASKFWR---PGRMTGLPPPLP 31 Y C+ +NG PPSAS + P ++T +PP P Sbjct: 309 YTCVPSNGLLHPPSASAYLTVLYPAQVTAMPPETP 343 >AB065819-1|BAC06038.1| 329|Homo sapiens seven transmembrane helix receptor protein. Length = 329 Score = 30.3 bits (65), Expect = 4.6 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 527 PSLHQALLVMLCILAAFSLAITSSRTKRQVA 435 PSLHQ++ + L +LAA L + SS + +A Sbjct: 71 PSLHQSMYLFLSMLAAIDLVLASSTAPKALA 101 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,382,300 Number of Sequences: 237096 Number of extensions: 1415985 Number of successful extensions: 4847 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4840 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5421005376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -