BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C03 (437 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 29 0.055 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 29.5 bits (63), Expect = 0.055 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 8/97 (8%) Frame = +2 Query: 95 GDAIDKTSLQFLKETYTSSKDKNVVSSPLGV-MMLMLLYKA------GAGEGSRAEIDKF 253 G ++ L F+KE + + + NVV SP V ++L L+Y+A A ++ E+ Sbjct: 31 GQRQNEFDLMFVKEIF-KNHNSNVVLSPFSVKILLTLIYEASDTSFGNAVSNTKRELSSV 89 Query: 254 SGNGDYSGVANPYISLSKTFSEMNPDY-FTMANKIYV 361 N + + Y L ++ + N DY +A +V Sbjct: 90 IQNDNIDHTRSYYKQLLESAQQDNKDYDLNIATNFFV 126 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 451,459 Number of Sequences: 2352 Number of extensions: 8841 Number of successful extensions: 16 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -