BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C01 (298 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive ... 25 0.80 CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein ... 22 5.6 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 21 7.4 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 21 7.4 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 21 7.4 >AF203336-1|AAF19831.1| 187|Anopheles gambiae immune-responsive chymotrypsin-likeserine protease-related protein ISPR1 protein. Length = 187 Score = 24.6 bits (51), Expect = 0.80 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +2 Query: 89 IKY*KMAPSCALYVALACILAVVASDLPHPLSDAFXNLI 205 +K KM + LAC+ AS + HP+S N I Sbjct: 3 LKRGKMVVHIIFAILLACVSRGSASPIDHPISPFAANYI 41 >CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein protein. Length = 227 Score = 21.8 bits (44), Expect = 5.6 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = -2 Query: 285 PXNIVMCANGVCVGKFRPAFHVFCFLL 205 P IV C VC G+ + C L Sbjct: 117 PSMIVKCTRNVCTGRNEVPYREQCVKL 143 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 104 MAPSCALYVALACILAVVASDLPHPLSDA 190 MA Y+ L C+LAV A+ DA Sbjct: 17 MATVNLYYLGLVCLLAVTATAASQCFRDA 45 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 104 MAPSCALYVALACILAVVASDLPHPLSDA 190 MA Y+ L C+LAV A+ DA Sbjct: 1 MATVNLYYLGLVCLLAVTATAASQCFRDA 29 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 21.4 bits (43), Expect = 7.4 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 104 MAPSCALYVALACILAVVASDLPHPLSDA 190 MA Y+ L C+LAV A+ DA Sbjct: 17 MATVNLYYLGLVCLLAVTATAASQCFRDA 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 301,367 Number of Sequences: 2352 Number of extensions: 5181 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 18688617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -