BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_C01 (298 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43990.2 68418.m05382 SET domain-containing protein identical... 27 3.0 At5g43990.1 68418.m05383 SET domain-containing protein identical... 27 3.0 At3g51360.1 68416.m05624 aspartyl protease family protein contai... 26 3.9 At5g01550.1 68418.m00070 lectin protein kinase, putative similar... 26 5.2 At4g29720.1 68417.m04232 amine oxidase family protein similar to... 26 5.2 At5g05240.1 68418.m00560 expressed protein similar to unknown pr... 25 6.9 At4g23150.1 68417.m03341 protein kinase family protein contains ... 25 6.9 At3g48760.1 68416.m05325 zinc finger (DHHC type) family protein ... 25 6.9 At5g06570.2 68418.m00742 expressed protein similar to PrMC3 [Pin... 25 9.1 At5g06570.1 68418.m00741 expressed protein similar to PrMC3 [Pin... 25 9.1 At3g59910.1 68416.m06686 expressed protein 25 9.1 At3g20280.1 68416.m02569 PHD finger family protein contains Pfam... 25 9.1 >At5g43990.2 68418.m05382 SET domain-containing protein identical to SET domain protein SUVR2 [Arabidopsis thaliana] GI:15290521; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif; identical to cDNA SET domain protein SUVR2 GI:15290520 Length = 740 Score = 26.6 bits (56), Expect = 3.0 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 121 SVRRARVYSRCCGQ*LAPS-ALRCVYXFD 204 ++R + S CCG LAPS A RC F+ Sbjct: 462 NIRDDQCCSSCCGDCLAPSMACRCATAFN 490 >At5g43990.1 68418.m05383 SET domain-containing protein identical to SET domain protein SUVR2 [Arabidopsis thaliana] GI:15290521; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif; identical to cDNA SET domain protein SUVR2 GI:15290520 Length = 717 Score = 26.6 bits (56), Expect = 3.0 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +1 Query: 121 SVRRARVYSRCCGQ*LAPS-ALRCVYXFD 204 ++R + S CCG LAPS A RC F+ Sbjct: 439 NIRDDQCCSSCCGDCLAPSMACRCATAFN 467 >At3g51360.1 68416.m05624 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 488 Score = 26.2 bits (55), Expect = 3.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -2 Query: 231 AFHVFCFLLIKXINASESGWGKSLATTARI 142 +F V+C ++K +NA S G++ T RI Sbjct: 390 SFQVYCLAVLKQVNADFSIIGQNFMTNYRI 419 >At5g01550.1 68418.m00070 lectin protein kinase, putative similar to receptor lectin kinase 3 [Arabidopsis thaliana] gi|4100060|gb|AAD00733; contains protein kinase domain, Pfam:PF00069; contains legume lectins alpha and beta domains, Pfam:PF00138 and Pfam:PF00139 Length = 688 Score = 25.8 bits (54), Expect = 5.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 40 RLSYASIY*PIDSVKENKILKDGSF 114 RL Y +Y D KEN+I+ G F Sbjct: 348 RLRYKDLYAATDGFKENRIVGTGGF 372 >At4g29720.1 68417.m04232 amine oxidase family protein similar to polyamine oxidase isoform-2 [Homo sapiens] GI:16554963; contains Pfam profile PF01593: amine oxidase, flavin-containing Length = 533 Score = 25.8 bits (54), Expect = 5.2 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = -1 Query: 190 RI*ERMGQVTGHNSENTRERDV----QSTRRSHLSVFYFLLQS--RSVNKLTRN 47 +I +++GQV GH+ E V ++T R+H S + S R N+L ++ Sbjct: 475 KINKKVGQVNGHDQAKVHELQVMFAGEATHRTHYSTTHGAYYSGLREANRLLKH 528 >At5g05240.1 68418.m00560 expressed protein similar to unknown protein (gb AAD32815.2) Length = 530 Score = 25.4 bits (53), Expect = 6.9 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +1 Query: 67 PIDSVKENKILKDGSFVCSVRRARVYSRC 153 P+DS N ++ D V A +YS C Sbjct: 492 PLDSRAANALISDKDLVIKAAAASIYSTC 520 >At4g23150.1 68417.m03341 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 659 Score = 25.4 bits (53), Expect = 6.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -1 Query: 208 INQIXKRI*ERMGQVTGHNSENTRERDVQSTRRSHLSVFYFLLQ 77 INQ + M Q+ ++N R+ T + L FY L+Q Sbjct: 157 INQFTNLVLSNMNQIAIEAADNPRKFSTIKTELTALQTFYGLVQ 200 >At3g48760.1 68416.m05325 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 476 Score = 25.4 bits (53), Expect = 6.9 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -2 Query: 273 VMCANGVCVGKFRPAFHVFCFLLIKXINASE--SGWGKSLATTARI 142 V+C+ +C+ HVFC++ +K I SE + W L T A I Sbjct: 207 VLCSTLLCI-----YVHVFCWIYVKRIMDSENINIWKSFLKTPASI 247 >At5g06570.2 68418.m00742 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 25.0 bits (52), Expect = 9.1 Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 285 PXNIVMCANGVCVG-KFRPAFHVFCFLLIKXINA 187 P + G C G + P FH FC L +NA Sbjct: 77 PVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLNA 110 >At5g06570.1 68418.m00741 expressed protein similar to PrMC3 [Pinus radiata] GI:5487873 Length = 329 Score = 25.0 bits (52), Expect = 9.1 Identities = 12/34 (35%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = -2 Query: 285 PXNIVMCANGVCVG-KFRPAFHVFCFLLIKXINA 187 P + G C G + P FH FC L +NA Sbjct: 77 PVVVFFHGGGFCFGSRSWPHFHNFCLTLASSLNA 110 >At3g59910.1 68416.m06686 expressed protein Length = 611 Score = 25.0 bits (52), Expect = 9.1 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 240 FRPAFHVFCFLLIKXINASESGWGKSLATT 151 F AF CF L N+ + GW ++ T Sbjct: 279 FTEAFDAACFPLTLFSNSFDPGWASGMSAT 308 >At3g20280.1 68416.m02569 PHD finger family protein contains Pfam profile: PF00628 PHD-finger Length = 743 Score = 25.0 bits (52), Expect = 9.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 171 PIRSQMRLXI*LIRNKTHGKLAGTSRRIHRLHTSQY 278 PI+S +R R HG GT++ +H TS + Sbjct: 235 PIQSSVRTADPSFRPFRHGTFTGTNQPMHYSQTSSF 270 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,025,577 Number of Sequences: 28952 Number of extensions: 105676 Number of successful extensions: 264 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 264 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 281229760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -