BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_B24 (676 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16C6.13c |sec27||coatomer beta' subunit |Schizosaccharomyces... 29 0.61 SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces ... 27 3.3 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 27 3.3 SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||M... 25 7.6 SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizo... 25 10.0 SPBC776.05 |||membrane transporter |Schizosaccharomyces pombe|ch... 25 10.0 >SPBC16C6.13c |sec27||coatomer beta' subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 796 Score = 29.1 bits (62), Expect = 0.61 Identities = 19/44 (43%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 663 CIVVINDNTLI--GFQVGFPQPSLCCRKDPGVRCSSSGSTVWRN 538 CI DN L+ GF G SL R +P V SSG VW N Sbjct: 275 CIAQNKDNGLVTVGFDNGLITFSLG-RDEPSVTMDSSGKVVWSN 317 >SPAC6B12.02c |mus7||DNA repair protein Mus7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1888 Score = 26.6 bits (56), Expect = 3.3 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 637 PYWIPGWFSTTFTLLSQGPGCSM 569 P+W G +STTF +++ PG S+ Sbjct: 661 PFWNIGIWSTTFNVITFRPGLSL 683 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 26.6 bits (56), Expect = 3.3 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 296 LPHTYPLSRPIFKSLCVLSLSQI 228 +P +P S+PI+K LC++ L I Sbjct: 582 VPRRFPGSKPIWKRLCIIVLIAI 604 >SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 25.4 bits (53), Expect = 7.6 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = -1 Query: 79 NIPSIFILCYCLWHK 35 ++PSI+ILC+C H+ Sbjct: 34 SLPSIYILCHCSKHQ 48 >SPAC767.01c |vps1|SPAC9G1.14c|dynamin family protein Vps1|Schizosaccharomyces pombe|chr 1|||Manual Length = 678 Score = 25.0 bits (52), Expect = 10.0 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 303 LASVPSYCPVXVAQTGTLTLINVPGV 380 ++SVP Y + TLTL+++PG+ Sbjct: 132 ISSVPIYLRIYSPHVLTLTLVDLPGL 157 >SPBC776.05 |||membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 404 Score = 25.0 bits (52), Expect = 10.0 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -1 Query: 535 NRHGLPSVSDAVATANLFDLP---RADTWLY 452 N +GL + D+V +LFD P R +WL+ Sbjct: 21 NDYGLHGLDDSVGFTDLFDAPNIYRVYSWLH 51 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,648,107 Number of Sequences: 5004 Number of extensions: 51083 Number of successful extensions: 113 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -