SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0006_B24
         (676 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alph...    23   3.5  
DQ288392-1|ABC41342.1|  120|Apis mellifera nanos protein.              22   6.1  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    21   8.1  
AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine beta-sy...    21   8.1  

>AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alpha
           protein precursor protein.
          Length = 153

 Score = 22.6 bits (46), Expect = 3.5
 Identities = 11/33 (33%), Positives = 13/33 (39%)
 Frame = -2

Query: 612 PQPSLCCRKDPGVRCSSSGSTVWRNSTGTDCRQ 514
           P PS  CR         SGS +W+      C Q
Sbjct: 47  PIPSYACRGRCSSYLQVSGSKIWQMERSCMCCQ 79


>DQ288392-1|ABC41342.1|  120|Apis mellifera nanos protein.
          Length = 120

 Score = 21.8 bits (44), Expect = 6.1
 Identities = 8/22 (36%), Positives = 10/22 (45%)
 Frame = +3

Query: 303 LASVPSYCPVXVAQTGTLTLIN 368
           +A    YCP      GTL  +N
Sbjct: 84  IAHTVKYCPKGTKNPGTLATVN 105


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 7/13 (53%), Positives = 7/13 (53%)
 Frame = -1

Query: 244 CPSRKYQEALGCW 206
           CP   YQ  L CW
Sbjct: 863 CPEAIYQLMLDCW 875


>AB244761-1|BAE66603.1|  504|Apis mellifera cystathionine
           beta-synthase protein.
          Length = 504

 Score = 21.4 bits (43), Expect = 8.1
 Identities = 8/13 (61%), Positives = 8/13 (61%)
 Frame = -2

Query: 444 TLTSWHSPRCFIS 406
           T  SWHSP   IS
Sbjct: 152 TEASWHSPEAHIS 164


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,955
Number of Sequences: 438
Number of extensions: 3670
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 20464920
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -