BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_B23 (655 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces ... 27 2.4 SPBC1706.03 |fzo1|SPBC839.01|mitochondrial fusion GTPase protein... 26 4.1 SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr ... 25 9.5 SPAC11E3.13c |||1,3-beta-glucanosyltransferase |Schizosaccharomy... 25 9.5 >SPBC577.06c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1877 Score = 27.1 bits (57), Expect = 2.4 Identities = 21/91 (23%), Positives = 42/91 (46%), Gaps = 3/91 (3%) Frame = +1 Query: 127 FVLDTSGS---MSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITVHELSEADKEKTR 297 F+L+TSG+ + + + +K +Y P I+D ++ LS DK+ Sbjct: 1446 FILETSGTSQLFAHQILWNMKANLYKDEAATVPDSIKPILDRVMDKMINSLSGEDKQFYE 1505 Query: 298 YKYFYYNEIQPKLDLVAPYQATPENIEKAKI 390 ++ ++NE+ + P+ + +KAKI Sbjct: 1506 REFTFFNEVTSISGKLKPFIRKSKPEKKAKI 1536 >SPBC1706.03 |fzo1|SPBC839.01|mitochondrial fusion GTPase protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 758 Score = 26.2 bits (55), Expect = 4.1 Identities = 25/100 (25%), Positives = 47/100 (47%) Frame = +1 Query: 172 QLKEAMYTILNELNPGDYFSIIDFESIITVHELSEADKEKTRYKYFYYNEIQPKLDLVAP 351 QL +++ I N LN D + +D S H + DKEK+++ YY K++++ Sbjct: 49 QLLRSIHIIQNLLNELDNY--VD-RSDCLFHSVWRTDKEKSKFSGNYYPFSPSKMNVITI 105 Query: 352 YQATPENIEKAKIIISRLESIGGTDINTALTVAVDLINKY 471 + + + +IS+L G + L V ++ NK+ Sbjct: 106 DLSLRSSSTADEKLISQL---GEEAHESLLKVHIEKANKH 142 >SPBC713.06 |adl1|lig3|DNA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 774 Score = 25.0 bits (52), Expect = 9.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 639 DSWIAVCQEYDNRFQGFD 586 + WI V Q+YD+ F+ D Sbjct: 609 EGWIKVKQDYDDEFESLD 626 >SPAC11E3.13c |||1,3-beta-glucanosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 510 Score = 25.0 bits (52), Expect = 9.5 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +1 Query: 112 NKYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFS 231 N Y + V+D + E LKE + N GDY S Sbjct: 307 NNYGLVVIDGDNVTISKNYETLKEKYASAANYTGDGDYSS 346 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.317 0.138 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,698,477 Number of Sequences: 5004 Number of extensions: 54256 Number of successful extensions: 164 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 295793106 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -