BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_B23 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 45 2e-06 AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 26 0.90 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 24 3.7 DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor... 24 4.8 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 23 6.4 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 23 6.4 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 23 6.4 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 23 8.4 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 8.4 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 23 8.4 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 23 8.4 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 8.4 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 8.4 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 45.2 bits (102), Expect = 2e-06 Identities = 34/119 (28%), Positives = 59/119 (49%) Frame = +1 Query: 115 KYVVFVLDTSGSMSGRKMEQLKEAMYTILNELNPGDYFSIIDFESIITVHELSEADKEKT 294 K V+ +LD+SGSMSG++ + IL+ L D+F++I F +D+ + Sbjct: 268 KDVIILLDSSGSMSGKEYQLAVATASAILDTLGDDDFFNLISF-----------SDQSRV 316 Query: 295 RYKYFYYNEIQPKLDLVAPYQATPENIEKAKIIISRLESIGGTDINTALTVAVDLINKY 471 F Q K+ +ATP+N+++ K I+ +E + + AL A +L+ KY Sbjct: 317 IVPCF-----QDKM-----VRATPDNVKEVKTAINAVECENTANFSAALETAFELLRKY 365 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 26.2 bits (55), Expect = 0.90 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -3 Query: 221 SPGFSSFNIVY--IASFNCSILRPDMDPDVSRTKTTY 117 SP F + N++ +F + LR D+ PD +R T Y Sbjct: 85 SPPFPNTNVILKPYPNFALNELRADLQPDANRIVTVY 121 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 292 TRYKYFYYNEIQPKLDLV 345 T Y Y+Y+ +I PK+ LV Sbjct: 148 TGYLYYYHYQIFPKISLV 165 >DQ989011-1|ABK97612.1| 467|Anopheles gambiae gustatory receptor 22 protein. Length = 467 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 58 EFVHLSVDLHHIVQQI 11 E+ HL VDL H++QQ+ Sbjct: 283 EYRHLWVDLSHMMQQL 298 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 74 YPSFTRICPSFGRSTSY 24 YP+ T+ P++GRS +Y Sbjct: 48 YPTETQRAPAYGRSQAY 64 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 74 YPSFTRICPSFGRSTSY 24 YP+ T+ P++GRS +Y Sbjct: 48 YPTETQRAPAYGRSQAY 64 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 337 PTLVEFRCNKSIYT 296 P + F C+KSIYT Sbjct: 536 PVIENFNCDKSIYT 549 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 74 YPSFTRICPSFGRSTSY 24 YP+ T+ P++GRS +Y Sbjct: 47 YPTETQRSPAYGRSQAY 63 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 74 YPSFTRICPSFGRSTSY 24 YP+ T+ P++GRS +Y Sbjct: 47 YPTETQRSPAYGRSQAY 63 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 74 YPSFTRICPSFGRSTSY 24 YP+ T+ P++GRS +Y Sbjct: 47 YPTETQRSPAYGRSQAY 63 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 74 YPSFTRICPSFGRSTSY 24 YP+ T+ P++GRS +Y Sbjct: 47 YPTETQRSPAYGRSQAY 63 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 74 YPSFTRICPSFGRSTSY 24 YP+ T+ P++GRS +Y Sbjct: 119 YPTETQRSPAYGRSQAY 135 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 8.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 74 YPSFTRICPSFGRSTSY 24 YP+ T+ P++GRS +Y Sbjct: 118 YPTETQRSPAYGRSQAY 134 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.138 0.390 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 681,164 Number of Sequences: 2352 Number of extensions: 13453 Number of successful extensions: 28 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -