BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_B21 (487 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 29 2.2 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 29 2.2 At1g09540.1 68414.m01070 myb family transcription factor (MYB61)... 29 2.2 At3g20475.1 68416.m02592 DNA mismatch repair MutS family protein... 28 3.8 At1g17500.1 68414.m02150 haloacid dehalogenase-like hydrolase fa... 28 3.8 At2g18890.1 68415.m02204 protein kinase family protein contains ... 27 5.1 At1g53040.2 68414.m06006 expressed protein contains Pfam profile... 27 5.1 At1g53040.1 68414.m06005 expressed protein contains Pfam profile... 27 5.1 At5g67150.1 68418.m08465 transferase family protein similar to a... 27 6.7 At4g25850.1 68417.m03718 oxysterol-binding family protein contai... 27 6.7 At3g05680.1 68416.m00634 expressed protein 27 6.7 At2g01480.1 68415.m00071 expressed protein contains Pfam PF03138... 27 6.7 At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase fa... 27 8.9 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 28.7 bits (61), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 27 AAVSAAPYYGMGYN-QMPFHPEHHHNRLRSPY 119 A + +PYY GY+ Q P P HH+ L PY Sbjct: 187 ATIMPSPYY-YGYSLQAPRVPYQHHHHLPQPY 217 Score = 27.1 bits (57), Expect = 6.7 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 45 PYYGMGYNQMPFHPE-HHHNRLRSPYF 122 PY + P++P+ HHH R SP F Sbjct: 206 PYQHHHHLPQPYNPQQHHHQRFSSPSF 232 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 28.7 bits (61), Expect = 2.2 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 27 AAVSAAPYYGMGYN-QMPFHPEHHHNRLRSPY 119 A + +PYY GY+ Q P P HH+ L PY Sbjct: 187 ATIMPSPYY-YGYSLQAPRVPYQHHHHLPQPY 217 Score = 27.1 bits (57), Expect = 6.7 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 45 PYYGMGYNQMPFHPE-HHHNRLRSPYF 122 PY + P++P+ HHH R SP F Sbjct: 206 PYQHHHHLPQPYNPQQHHHQRFSSPSF 232 >At1g09540.1 68414.m01070 myb family transcription factor (MYB61) contains PFAM profile: myb DNA-binding domain PF00249 Length = 366 Score = 28.7 bits (61), Expect = 2.2 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +3 Query: 144 GRFWSELSSELR-ELDNMLADFYRKFPTPASSSQGIEGNEYKVTIPLTSFDEKD 302 G WS+++S L DN + + + +GI+ N +K + SF +KD Sbjct: 86 GNRWSQIASRLPGRTDNEIKNLWNSSIKKKLKQRGIDPNTHKPISEVESFSDKD 139 >At3g20475.1 68416.m02592 DNA mismatch repair MutS family protein similar to SP|O43196 MutS protein homolog 5 {Homo sapiens}; contains Pfam profile PF00488: MutS domain V Length = 321 Score = 27.9 bits (59), Expect = 3.8 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 138 DTGRFWSELSSELRELDNMLADFYRK 215 +T RF+ +S+ RELDN+L D Y K Sbjct: 4 ETQRFFYH-TSKTRELDNLLGDIYHK 28 >At1g17500.1 68414.m02150 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|O43520], Mus musculus [SP|P70704]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1218 Score = 27.9 bits (59), Expect = 3.8 Identities = 16/54 (29%), Positives = 22/54 (40%) Frame = +3 Query: 21 LAAAVSAAPYYGMGYNQMPFHPEHHHNRLRSPYFGEDVFDTGRFWSELSSELRE 182 L + PY+ Q HP HH Y+ DV D R W+ ++ RE Sbjct: 1124 LVTVTTVLPYFAHISFQRFLHPLDHHIIQEIKYYKRDVEDR-RMWTRERTKARE 1176 >At2g18890.1 68415.m02204 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 392 Score = 27.5 bits (58), Expect = 5.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 408 GHVLHPNILSVPGGC 364 GHV HPN+LS+ G C Sbjct: 121 GHVSHPNVLSLLGCC 135 >At1g53040.2 68414.m06006 expressed protein contains Pfam profile: PF04765 protein of unknown function (DUF616) Length = 540 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 338 CLSAXXPHPQPPGTERIFGCRTCPDCVM*TELGL 439 C S P P PPG R G R CP C + E L Sbjct: 119 CDSFSFPPPPPPGMRRP-GPRPCPVCYLPPEEAL 151 >At1g53040.1 68414.m06005 expressed protein contains Pfam profile: PF04765 protein of unknown function (DUF616) Length = 540 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +2 Query: 338 CLSAXXPHPQPPGTERIFGCRTCPDCVM*TELGL 439 C S P P PPG R G R CP C + E L Sbjct: 119 CDSFSFPPPPPPGMRRP-GPRPCPVCYLPPEEAL 151 >At5g67150.1 68418.m08465 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 448 Score = 27.1 bits (57), Expect = 6.7 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +3 Query: 132 VFDTGRFWSELSSELRELDNML-ADFYRKFPTPASSSQGIEGNEYKVTIPL 281 V D FWS ++ N AD RKFP ++G EY + IPL Sbjct: 169 VADGSSFWSFFNTWSEICFNGFDADHRRKFPPLLLRGWFLDGIEYPIRIPL 219 >At4g25850.1 68417.m03718 oxysterol-binding family protein contains Pfam profile PF01237: Oxysterol-binding protein Length = 383 Score = 27.1 bits (57), Expect = 6.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 90 VPDGKAFGCTPYRSTVPP 37 V DGK + C+P + TVPP Sbjct: 360 VKDGKDWDCSPLQPTVPP 377 >At3g05680.1 68416.m00634 expressed protein Length = 2057 Score = 27.1 bits (57), Expect = 6.7 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 4/55 (7%) Frame = +3 Query: 126 EDVFDTG---RFWSELSSELRE-LDNMLADFYRKFPTPASSSQGIEGNEYKVTIP 278 +D++ G +FW E L E L RK PT SSS+ +G V IP Sbjct: 1400 DDLYQRGLEDKFWWECPETLPERLPQSSLPAKRKLPTLESSSRRAKGENSSVDIP 1454 >At2g01480.1 68415.m00071 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'axi 1 protein from Nicotiana tabacum -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 567 Score = 27.1 bits (57), Expect = 6.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +3 Query: 90 HHHNRLRSPYFGEDVFDTGRFWSELSSELRELDNM 194 H+H+ R P D++D F S LS+++R +D + Sbjct: 193 HYHSIWRDPSKFGDIYDEEFFVSTLSNDVRVVDTI 227 >At1g72700.1 68414.m08407 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from Homo sapiens [SP|Q9Y2Q0, SP|O43520]; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1228 Score = 26.6 bits (56), Expect = 8.9 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +3 Query: 21 LAAAVSAAPYYGMGYNQMPFHPEHHHNRLRSPYFGEDVFDTGRFWSELSSELRE 182 L + PY Q +P HH Y+G D+ D R W+ ++ RE Sbjct: 1134 LVTVAAVLPYVAHIAFQRFLNPLDHHIIQEIKYYGRDIED-ARLWTRERTKARE 1186 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,207,124 Number of Sequences: 28952 Number of extensions: 227502 Number of successful extensions: 760 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 838967680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -