BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_B15 (550 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.7 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 23 2.7 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.7 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 3.6 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 6.2 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 8.2 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 2.7 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = -2 Query: 150 ISPVATPIPYGFKAFDIVACPSTSSGEVGSSIHIGF 43 +SP A GF ++ S S +IH+ F Sbjct: 109 LSPAAVSYTSGFYHIPVIGISSRDSAFSDKNIHVSF 144 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 22.6 bits (46), Expect = 2.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 204 YCIAPLCRNCLNRTRFA 154 Y + CRNC++ T F+ Sbjct: 29 YLVRAFCRNCIHPTVFS 45 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.6 bits (46), Expect = 2.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 204 YCIAPLCRNCLNRTRFA 154 Y + CRNC++ T F+ Sbjct: 477 YLVRAFCRNCIHPTVFS 493 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 474 IAHNSCLPHWKSTRIQE 524 I HN+CL STRI + Sbjct: 294 IQHNNCLTRIPSTRINK 310 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 253 RLSNGRKTWS 282 RL +GRKTW+ Sbjct: 515 RLDHGRKTWT 524 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.0 bits (42), Expect = 8.2 Identities = 6/16 (37%), Positives = 11/16 (68%) Frame = +3 Query: 213 STRPASEASTKFYPFI 260 ST PA+ ++ YP++ Sbjct: 77 STSPAARTTSSMYPYV 92 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,818 Number of Sequences: 438 Number of extensions: 4191 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -