BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_B13 (540 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces ... 30 0.25 SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosacch... 27 1.3 SPAC6B12.09 |trm10||tRNA m|Schizosaccharomyces pombe|chr 1|||Manual 27 2.3 SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|c... 25 7.2 SPCC1235.09 |||histone deacetylase complex subunit|Schizosacchar... 25 7.2 SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces p... 25 9.5 SPBC1289.16c ||SPBC8E4.06|copper amine oxidase |Schizosaccharomy... 25 9.5 >SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 528 Score = 29.9 bits (64), Expect = 0.25 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 116 PEKGLSLFQDVDQVNVDDEYYKIGKDYDVEANIDNYTNKKAVE 244 P K L + + + YYK+ K Y +AN D K VE Sbjct: 87 PYKTLGVSKSASASEIKSAYYKLAKQYHPDANPDKAAQDKFVE 129 >SPAC26F1.09 |gyp51||GTPase activating protein Gyp51 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1031 Score = 27.5 bits (58), Expect = 1.3 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 113 APEKGLSLFQDVDQVNVDDEYYKIGKDYDVEANIDN 220 +P+ Q+V Q+N +DEY + + D EA IDN Sbjct: 46 SPDLNFFSTQNVMQMNFEDEYSEFSNE-DDEAEIDN 80 >SPAC6B12.09 |trm10||tRNA m|Schizosaccharomyces pombe|chr 1|||Manual Length = 304 Score = 26.6 bits (56), Expect = 2.3 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -2 Query: 275 DNRFCTISRILQQLSYWCSYRCW 207 D + T++++ + LS W YR W Sbjct: 239 DRKILTVNQVFEILSLWLEYRDW 261 >SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 392 Score = 25.0 bits (52), Expect = 7.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 203 EANIDNYTNKKAVEEFLKLYRIGYLPK 283 E + N+T ++A+EE KL LPK Sbjct: 270 EERLTNFTEEEAIEECKKLNTKSMLPK 296 >SPCC1235.09 |||histone deacetylase complex subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 564 Score = 25.0 bits (52), Expect = 7.2 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +2 Query: 410 NEGQFL-YAYYIAVIQRNDTHG 472 N G FL YA++ VI+ D+HG Sbjct: 274 NSGSFLAYAFFSGVIEIYDSHG 295 >SPAC22H12.05c |||fasciclin domain protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 728 Score = 24.6 bits (51), Expect = 9.5 Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 54 VVSPKTYHFKTK-DVDAVFVERQKKVY 131 V+ PKT+H+K + F + QKK++ Sbjct: 234 VIEPKTFHYKNGISISMKFDKDQKKLF 260 >SPBC1289.16c ||SPBC8E4.06|copper amine oxidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 794 Score = 24.6 bits (51), Expect = 9.5 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 44 AIQCGVTENVSLQDKRCRRSVCGAPEKGLS-LFQDVDQVNVDDEY 175 AI + N + ++C+ +CG PE GLS ++ D + D+ Y Sbjct: 113 AITDEIVRNDANVIEQCK--ICGVPESGLSNVYCDPWTIGYDERY 155 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,158,688 Number of Sequences: 5004 Number of extensions: 42097 Number of successful extensions: 120 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -