BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_B05 (535 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8342| Best HMM Match : FKBP_C (HMM E-Value=0) 168 2e-42 SB_19729| Best HMM Match : No HMM Matches (HMM E-Value=.) 120 1e-27 SB_53649| Best HMM Match : FKBP_C (HMM E-Value=4.1e-05) 35 0.036 SB_830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_52570| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) 28 4.2 SB_55256| Best HMM Match : Lamp (HMM E-Value=0.55) 28 4.2 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 28 5.5 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) 28 5.5 SB_1724| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.5 SB_12811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_8342| Best HMM Match : FKBP_C (HMM E-Value=0) Length = 266 Score = 168 bits (409), Expect = 2e-42 Identities = 82/153 (53%), Positives = 106/153 (69%), Gaps = 2/153 (1%) Frame = +3 Query: 69 VFVMLALVGATI-ADSEVTELKIDVLSVPEGCTTKSKDGDMLTMHYTGTLSDGHKFDSSF 245 + ++A G + A+ ELKI+V+S PE CT K+ GD L+MHYTG L++G+KFDSS Sbjct: 7 LLAIVAFSGLALGAEEPKGELKIEVVSKPEKCTRKTHVGDTLSMHYTGRLANGNKFDSSL 66 Query: 246 DRDQPFTFQLGVGQVIKGWDQGLRDMCVGEKRKLTIPSSLGYGNRGAGNVIPPHATLHFE 425 DR + F F LG G VI+GW+QGL DMC+GEKRKLTIP L YG GAG IPPHATL+ + Sbjct: 67 DRGKTFDFTLGKGMVIQGWEQGLLDMCIGEKRKLTIPPHLAYGENGAGAAIPPHATLYMD 126 Query: 426 VELINI-GDSPPTTNVFKEIDADQNNMLSREEV 521 VEL+ I G NVF ID + + +L++EEV Sbjct: 127 VELVEIQGSKESDPNVFGMIDKNNDKVLTQEEV 159 >SB_19729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 120 bits (288), Expect = 1e-27 Identities = 58/141 (41%), Positives = 90/141 (63%), Gaps = 7/141 (4%) Frame = +3 Query: 123 ELKIDVLSVPEGCTTKSKDGDMLTMHYTGTLSDGHKFDSSFDRD---QPFTFQLGVGQVI 293 +++++ VP C K+K GD + +HYTG + DG FD++ D QPF F +G G VI Sbjct: 99 KIEVEETFVPSDCENKTKVGDHVVVHYTGWMQDGSLFDTTRDHRKGYQPFEFTIGGGTVI 158 Query: 294 KGWDQGLRDMCVGEKRKLTIPSSLGYGNRGA----GNVIPPHATLHFEVELINIGDSPPT 461 KG++QG+ MCVG+KRK+ IP +L YG +G+ GN+ + TL + +EL ++ PP Sbjct: 159 KGFEQGVTGMCVGQKRKIVIPPALAYGKKGSGDVPGNLDLTNTTLTYNLELFDVRKPPPH 218 Query: 462 TNVFKEIDADQNNMLSREEVS 524 +++F +D + + LSREEVS Sbjct: 219 SDMFSHMDENGDRKLSREEVS 239 >SB_53649| Best HMM Match : FKBP_C (HMM E-Value=4.1e-05) Length = 639 Score = 35.1 bits (77), Expect = 0.036 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 4/44 (9%) Frame = +3 Query: 180 GDMLTMHYTGTLSD----GHKFDSSFDRDQPFTFQLGVGQVIKG 299 GD + + YTG L + G FDS+ D+ F F+ G G+VIKG Sbjct: 122 GDAVEVKYTGWLLENGNFGKVFDSNAGTDKTFKFKTGKGKVIKG 165 >SB_830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1390 Score = 30.3 bits (65), Expect = 1.0 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Frame = +3 Query: 228 KFDSSF--DRDQPFTFQLGVGQVIKGWDQGLRDMCVGEKRKL-TIPSSLGYGNRG 383 K DS+F + +P +F +G GWD G G +KL T PS+ G N G Sbjct: 291 KLDSTFIWSKIRPMSFPCVLGMHEVGWDDGTFHSSTGAAQKLGTRPSNGGTKNSG 345 >SB_52570| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 3.2 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = -3 Query: 338 FLTYTHVSKSLIPAFDDLTDAELKGEWLIAIKTGVELMTIAQSTRVVHGQHITIFRLRST 159 + T ++ ++ +IP D LT +++ TG TI+ + R V H+T ++R+T Sbjct: 4 YQTNSYANRCVIP--DHLTRQQVRTTRPSHTPTGAYYQTISHANRCVLPDHLTRQQVRTT 61 Query: 158 SFGHAQ 141 H Q Sbjct: 62 RPSHTQ 67 >SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.7 bits (61), Expect = 3.2 Identities = 27/84 (32%), Positives = 37/84 (44%), Gaps = 6/84 (7%) Frame = +2 Query: 269 SARRRSSHQRLGSRTSRH-VCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSRTNQH- 442 S S H+ TSRH R ET + H + R TSRH S R +T++H Sbjct: 37 SRHETSRHESSPHETSRHETSRHET-SRHERSRHETRQHERSRHKTSRHESSRHKTSRHG 95 Query: 443 --R*LTPDHQ--RVQGNRRGPKQH 502 R T H+ R + +R +QH Sbjct: 96 RSRHKTSRHETSRHERSRHETRQH 119 >SB_59669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3511 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 371 VAQGRRDGQFTFLTYTHVSKSLIPAFDDLTD 279 + +G +DG + FL H+S S +P D L + Sbjct: 3218 IKEGVKDGNWVFLANCHLSLSWMPQLDKLVE 3248 >SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) Length = 428 Score = 28.3 bits (60), Expect = 4.2 Identities = 23/66 (34%), Positives = 30/66 (45%) Frame = +2 Query: 248 SRSAIHLSARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRS 427 SRS+ LS+RRRS H+R R + + SRSR R S RS Sbjct: 279 SRSS-SLSSRRRSKHKRKSKRDRSRSRDRSSSKSKSLRRSKKYSRSRSRSSERRRRS-RS 336 Query: 428 RTNQHR 445 R+ +HR Sbjct: 337 RSTEHR 342 >SB_55256| Best HMM Match : Lamp (HMM E-Value=0.55) Length = 284 Score = 28.3 bits (60), Expect = 4.2 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = -1 Query: 193 VSISPSLDFVVHPSGTLKTSILSSVTSESAIVAPTRANITKTQ 65 V+I PS +H S ++ S+ SSV S VAPT T T+ Sbjct: 48 VTIVPST-ISMHSSPSISVSVASSVMPSSTSVAPTTPPATTTK 89 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 27.9 bits (59), Expect = 5.5 Identities = 24/62 (38%), Positives = 33/62 (53%) Frame = +2 Query: 251 RSAIHLSARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSR 430 RS H S R RS H+R SR++ R +D F R+SRSR + + HS RSR Sbjct: 256 RSRYHRS-RSRSRHRR--SRSNSPSMRK---SDRKFKKSQRKSRSRSRNRSRSHSRKRSR 309 Query: 431 TN 436 ++ Sbjct: 310 SS 311 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 27.9 bits (59), Expect = 5.5 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +2 Query: 272 ARRRSSHQRLGSRTSRHVCR*ET*TDHPFFLGLRQSRSRQCDPTSRHSSLRSRTN-QHR 445 +R RS +R SR+ R R + + H +SRSR P RHS RS T+ +HR Sbjct: 226 SRSRSPRRRRRSRSPRRRRRSRSPSPHH---RSHRSRSRSRSPRRRHSRSRSPTHRRHR 281 >SB_20049| Best HMM Match : 7tm_1 (HMM E-Value=6.2e-05) Length = 1023 Score = 27.9 bits (59), Expect = 5.5 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +3 Query: 135 DVLSVPEGCTTKSKDGDML-TMHYTGTLSDGHKFDSSFDR 251 D VP GC + + DG++L + T + + H D +FDR Sbjct: 59 DEPGVPAGCNSTAFDGNILEAYNLTMNIFEKHFVDRTFDR 98 >SB_1724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 899 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/64 (26%), Positives = 33/64 (51%) Frame = -3 Query: 338 FLTYTHVSKSLIPAFDDLTDAELKGEWLIAIKTGVELMTIAQSTRVVHGQHITIFRLRST 159 + T ++ ++ ++P D LT +++ TGV TI+ + R V H+T ++R+T Sbjct: 643 YQTISYANRCVLP--DHLTRQQVRTTRPSHTPTGVYYQTISHANRCVLPDHLTRQQVRTT 700 Query: 158 SFGH 147 H Sbjct: 701 RPSH 704 >SB_12811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1254 Score = 27.1 bits (57), Expect = 9.6 Identities = 16/64 (25%), Positives = 32/64 (50%) Frame = -3 Query: 338 FLTYTHVSKSLIPAFDDLTDAELKGEWLIAIKTGVELMTIAQSTRVVHGQHITIFRLRST 159 + T +H ++ ++P D L +++ +TG TI+ + R V H+T ++R+T Sbjct: 664 YQTISHANRCVLP--DHLIRQQVRTTRPSNTQTGAYYQTISHANRCVLPDHLTRQQVRTT 721 Query: 158 SFGH 147 H Sbjct: 722 RPSH 725 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,544,020 Number of Sequences: 59808 Number of extensions: 333548 Number of successful extensions: 946 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 938 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -