BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_B04 (488 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC806.07 |ndk1||nucleoside diphosphate kinase|Schizosaccharomy... 163 2e-41 SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pomb... 27 2.0 SPAC1039.07c |||4-aminobutyrate aminotransferase |Schizosaccharo... 26 2.7 SPCC553.02 |||glutamine-dependent NAD|Schizosaccharomyces pombe|... 25 8.1 >SPAC806.07 |ndk1||nucleoside diphosphate kinase|Schizosaccharomyces pombe|chr 1|||Manual Length = 151 Score = 163 bits (395), Expect = 2e-41 Identities = 72/120 (60%), Positives = 93/120 (77%) Frame = +2 Query: 128 ERTFLMVKPDGVQRGLVGTIIERFEKKGFKLVGLKFVWPSEELLQQHYSDLASRPFFPGL 307 E+TF+ VKPD VQRGL+G II +FE KG+KL LKF+ PS +L+++HY++ +PF+ L Sbjct: 4 EQTFIAVKPDAVQRGLIGYIISKFELKGYKLRALKFLVPSRDLVEEHYAEHKGKPFYEKL 63 Query: 308 VKYMSSGPVVPMVWEGLNVVKTGRQMLGATNPADSQPGTIRGDLCIQVGRNIIHGSDSVE 487 V +M+SGPV M+WEG VKTGR MLGA+NP DS PGTIRGD I +GRN+ HGSDS+E Sbjct: 64 VGFMASGPVCAMIWEGKQAVKTGRLMLGASNPLDSAPGTIRGDYGIDLGRNVCHGSDSIE 123 >SPBC1703.06 |pof10||F-box protein Pof10|Schizosaccharomyces pombe|chr 2|||Manual Length = 662 Score = 26.6 bits (56), Expect = 2.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 213 KPFFSKRSMIVPTRPR*TPSGLT 145 KPF +KRS ++P RP T L+ Sbjct: 512 KPFVNKRSKVLPLRPSVTHDNLS 534 >SPAC1039.07c |||4-aminobutyrate aminotransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 448 Score = 26.2 bits (55), Expect = 2.7 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = +2 Query: 305 LVKYMSSGPVVPMVWEGLNVVKTGRQMLGATNPADSQP--GTIRGDLCIQVGR--NIIH 469 L++ P++ V GL +++ G ++ T+P+ GT+ GD C+++G NI+H Sbjct: 349 LLRLKDKHPLIVDV-RGLGLLQ-GIEIASCTDPSKPSDFLGTVIGDKCLELGMNCNIVH 405 >SPCC553.02 |||glutamine-dependent NAD|Schizosaccharomyces pombe|chr 3|||Manual Length = 700 Score = 24.6 bits (51), Expect = 8.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 418 RYHSRRLMYPSWT 456 RY R+ +YPSWT Sbjct: 669 RYDLRQFLYPSWT 681 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,070,365 Number of Sequences: 5004 Number of extensions: 41074 Number of successful extensions: 92 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 190087364 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -