BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A24 (594 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 26 0.80 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 25 1.8 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 7.4 AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 23 7.4 AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding pr... 23 7.4 AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding pr... 23 7.4 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 9.8 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 26.2 bits (55), Expect = 0.80 Identities = 13/53 (24%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -3 Query: 343 RGPPXPSFSQKGPIQPFFLGGSSGMHCSHQTFNNFK--VVVDDLCEGCEAVSC 191 +GPP P + + + PF + S+ M C + K + ++ + GC C Sbjct: 62 KGPPVPKNAAECCVTPFLVEPSAFMTCHSKWIGQTKRQMAMEGIPRGCCVAEC 114 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 25.0 bits (52), Expect = 1.8 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +2 Query: 269 HATTATQKEWLNWTLLGKTGXGGPAMAVGLRNQQNIIPASTG 394 HA T + + WT KTG P L+N Q +TG Sbjct: 493 HANTVSSRVVRMWTNFAKTGNPTPGQDALLQNVQWPTVGATG 534 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.0 bits (47), Expect = 7.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 126 NMGASGPLGAEMITFLAPPT 67 N+GASG GAE PPT Sbjct: 175 NLGASGVPGAEPSRGSTPPT 194 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 188 CTTNCLAPLAKVIHDNFEI 244 C NCL AKV+ DN ++ Sbjct: 72 CYMNCLFHEAKVVDDNGDV 90 >AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding protein AgamOBP1 protein. Length = 144 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 188 CTTNCLAPLAKVIHDNFEI 244 C NCL AKV+ DN ++ Sbjct: 72 CYMNCLFHEAKVVDDNGDV 90 >AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding protein protein. Length = 144 Score = 23.0 bits (47), Expect = 7.4 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 188 CTTNCLAPLAKVIHDNFEI 244 C NCL AKV+ DN ++ Sbjct: 72 CYMNCLFHEAKVVDDNGDV 90 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 22.6 bits (46), Expect = 9.8 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 492 STTDTXATGTRKAIPVSFPLSLWNDFADSF 403 STT + + G R V+F ++LW+ + F Sbjct: 1028 STTKSLSGGERSYATVAFLIALWSCVSTPF 1057 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 628,521 Number of Sequences: 2352 Number of extensions: 12313 Number of successful extensions: 26 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57188952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -