BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A23 (570 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC622.12c |||NADP-specific glutamate dehydrogenase |Schizosacc... 27 1.5 SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pom... 27 2.6 SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizo... 25 5.9 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 25 5.9 SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo... 25 5.9 SPAC167.01 |ppk4||serine/threonine protein kinase Ppk4 |Schizosa... 25 7.8 SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosacchar... 25 7.8 >SPCC622.12c |||NADP-specific glutamate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 451 Score = 27.5 bits (58), Expect = 1.5 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = +3 Query: 159 DPAFYQLYNRIVGYINAFKHYLKPYPQEKLYFVGVKINDVVVEKLVTFFD 308 +P F Q Y IVG I + K + + +P+ K + I + V+E VT+ D Sbjct: 6 EPEFQQAYKEIVGSIESSKLF-EVHPELKRVLPIISIPERVLEFRVTWED 54 >SPBC1271.01c |pof13||F-box protein Pof13|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 26.6 bits (56), Expect = 2.6 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -2 Query: 233 IRLQVMLECVNVTH-NPVI*LIECRVSKCGLVKVKRTGHEGVLVEWF 96 I Q L+ + TH NPV EC +S+C L K G E L + F Sbjct: 233 ILFQNALDALPTTHGNPV----ECDISRCPLNACKIAGQETELADLF 275 >SPBC16D10.07c |sir2||Sir2 family histone deacetylase Sir2|Schizosaccharomyces pombe|chr 2|||Manual Length = 475 Score = 25.4 bits (53), Expect = 5.9 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 57 YEIVARHVLGAAPKPFDKHTFMPSALDFYQTALRD 161 Y +ARH L + FD HTF + FY T RD Sbjct: 183 YARLARHGLSEPSEMFDIHTFRENPEIFY-TFARD 216 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 25.4 bits (53), Expect = 5.9 Identities = 14/51 (27%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = -2 Query: 440 LNVDGNTERLVVESWLTNLEVVWVTSLNLFFGQEYTVSGI---KLAIVKEC 297 LN+ TE ++ ++ +V V S N FFG + G+ K ++ ++C Sbjct: 309 LNITRKTETILKSLKESSTPLVQVVSFNAFFGVMIAILGVQFFKASLNRQC 359 >SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizosaccharomyces pombe|chr 1|||Manual Length = 1403 Score = 25.4 bits (53), Expect = 5.9 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -2 Query: 353 FFGQEYTVSGIKLAIVKECD*FLNDNIIDFNADEIKFLLRIRLQV 219 F G+ + +S + I+ EC L N+ D +EI+ L R+ + V Sbjct: 1153 FIGELFKLSMLSEKIMHECIKRLLGNVTDPEEEEIESLCRLLMTV 1197 >SPAC167.01 |ppk4||serine/threonine protein kinase Ppk4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 25.0 bits (52), Expect = 7.8 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 166 HSISYITGLWVTLTHSSIT*SLILKRNFISSALKSMMLSLRN*SH 300 +S S I W T HSS+ +L R + S + ++ LRN H Sbjct: 973 NSKSVIGENWTTCLHSSLVDNLGKYRKYDGSKILDILRVLRNKRH 1017 >SPCC1672.07 |||U3 snoRNP-associated protein Utp21 |Schizosaccharomyces pombe|chr 3|||Manual Length = 902 Score = 25.0 bits (52), Expect = 7.8 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +1 Query: 91 HLNHSTSTPSCPVRLTF--TKPHFETLHSISYITGLWVTLT 207 HL S STPS LTF T + T H LW L+ Sbjct: 605 HLIDSISTPSVCTSLTFAPTGDYLATTHVDQVGISLWTNLS 645 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,381,361 Number of Sequences: 5004 Number of extensions: 48605 Number of successful extensions: 135 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 135 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 242064240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -