BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A23 (570 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC084158-23|AAP31422.1| 187|Caenorhabditis elegans Hypothetical... 30 1.3 AC084158-22|AAM15623.1| 214|Caenorhabditis elegans Hypothetical... 30 1.3 AC084158-21|AAK68581.1| 271|Caenorhabditis elegans Hypothetical... 30 1.3 Z81085-3|CAB03115.1| 769|Caenorhabditis elegans Hypothetical pr... 29 2.4 U80446-3|AAL77180.1| 889|Caenorhabditis elegans Nuclear pore co... 28 4.1 U80446-2|AAB37803.1| 1562|Caenorhabditis elegans Nuclear pore co... 28 4.1 U97001-5|AAB52260.3| 1592|Caenorhabditis elegans Temporarily ass... 28 5.4 U58761-2|AAB00713.1| 308|Caenorhabditis elegans Hypothetical pr... 27 9.5 >AC084158-23|AAP31422.1| 187|Caenorhabditis elegans Hypothetical protein Y69A2AR.7c protein. Length = 187 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +1 Query: 22 MKKKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHS 171 ++K QR+ +D+ + L +C +H+NH+ TP P + T FET S Sbjct: 104 LQKMRQRVADDIGEKVLDIC--EHINHNHYTPKMPTK-TEIPEIFETKFS 150 >AC084158-22|AAM15623.1| 214|Caenorhabditis elegans Hypothetical protein Y69A2AR.7b protein. Length = 214 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +1 Query: 22 MKKKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHS 171 ++K QR+ +D+ + L +C +H+NH+ TP P + T FET S Sbjct: 131 LQKMRQRVADDIGEKVLDIC--EHINHNHYTPKMPTK-TEIPEIFETKFS 177 >AC084158-21|AAK68581.1| 271|Caenorhabditis elegans Hypothetical protein Y69A2AR.7a protein. Length = 271 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +1 Query: 22 MKKKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHS 171 ++K QR+ +D+ + L +C +H+NH+ TP P + T FET S Sbjct: 177 LQKMRQRVADDIGEKVLDIC--EHINHNHYTPKMPTK-TEIPEIFETKFS 223 >Z81085-3|CAB03115.1| 769|Caenorhabditis elegans Hypothetical protein F46F3.4 protein. Length = 769 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +1 Query: 28 KKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLTFTKPHFETLHSISYIT 186 K+ Q+ ++L K++ H + STS+ P +TF+ P FE + S +T Sbjct: 325 KENQQKYSELSKMASTDPHSNHSSPSTSSQKAPTLITFSPPSFEQKINSSTMT 377 >U80446-3|AAL77180.1| 889|Caenorhabditis elegans Nuclear pore complex protein protein6, isoform b protein. Length = 889 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 97 NHSTSTPSCPVRLTFTKPHFETLHSISYIT--GLWVTLTHSSIT 222 +HS STP P+R + T H + ++ISY T G V +T S T Sbjct: 189 SHSLSTPGRPIRASVT--HHPSRNTISYCTAEGQLVIVTLGSYT 230 >U80446-2|AAB37803.1| 1562|Caenorhabditis elegans Nuclear pore complex protein protein6, isoform a protein. Length = 1562 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +1 Query: 97 NHSTSTPSCPVRLTFTKPHFETLHSISYIT--GLWVTLTHSSIT 222 +HS STP P+R + T H + ++ISY T G V +T S T Sbjct: 189 SHSLSTPGRPIRASVT--HHPSRNTISYCTAEGQLVIVTLGSYT 230 >U97001-5|AAB52260.3| 1592|Caenorhabditis elegans Temporarily assigned gene nameprotein 59 protein. Length = 1592 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 398 WLTNLEVVWVTSLNLFFGQEYTVSGIKLAIVKE 300 W+TNL + NL+F +Y + G L ++ + Sbjct: 142 WITNLHYAFQDEKNLYFVMDYYIGGDMLTLLSK 174 >U58761-2|AAB00713.1| 308|Caenorhabditis elegans Hypothetical protein C01F1.5 protein. Length = 308 Score = 27.1 bits (57), Expect = 9.5 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = +3 Query: 96 KPFDKHTFMPSALDFYQTALRDPAFYQLYNR 188 KP K F PS DF + LRD AF Q+ R Sbjct: 56 KPVQKVYFWPSLTDFEKNVLRD-AFAQIGRR 85 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,040,011 Number of Sequences: 27780 Number of extensions: 268555 Number of successful extensions: 735 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1187327456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -