BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A22 (519 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0369 - 9505330-9505652,9507262-9507532,9507649-9507690,950... 53 2e-07 01_01_1054 + 8330081-8330137,8330229-8330321,8330445-8330504,833... 33 0.14 06_03_1309 + 29223197-29223240,29223358-29223592,29223695-292237... 33 0.18 01_05_0420 + 21969797-21970939,21971307-21971369,21971488-219716... 33 0.18 07_01_0281 - 2067696-2068862 32 0.24 03_06_0523 + 34499533-34499705,34499808-34499917,34500037-345002... 32 0.32 12_02_0008 + 12239759-12239923,12240404-12240443,12241278-122414... 31 0.42 11_04_0274 - 15667178-15667444,15668352-15668678,15669430-156695... 31 0.55 08_01_0181 + 1530623-1531626,1531723-1531902,1531998-1532177,153... 31 0.73 01_07_0321 + 42715969-42716233,42716320-42716399,42716545-427166... 31 0.73 06_03_0766 - 24425486-24426245,24430766-24430855,24430951-244310... 30 0.97 04_04_1500 + 34010819-34011016,34013267-34013308,34014195-340142... 30 0.97 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 30 0.97 02_01_0703 + 5251901-5251950,5252783-5253554 30 1.3 06_02_0136 + 12195422-12195435,12196047-12196122,12196896-121977... 29 1.7 02_05_0300 + 27681204-27681656,27681745-27681840,27681933-276820... 29 1.7 06_03_0253 + 18753901-18754278,18754873-18754968,18755167-187553... 29 2.2 05_01_0578 + 5180538-5181385,5182480-5182595,5183397-5183605,518... 29 2.2 02_05_1041 - 33713561-33714564,33714844-33714904,33715640-337159... 29 2.2 08_01_0244 + 2016548-2017101,2017392-2019681,2019785-2019817 29 3.0 03_02_0709 + 10583621-10583626,10583711-10584712,10585304-10585669 29 3.0 07_03_1709 - 28873172-28873327,28873519-28873584,28874067-288741... 28 3.9 03_05_0799 + 27809301-27811550 28 3.9 03_02_0875 + 12038365-12039329,12039417-12039593,12039651-120398... 28 3.9 02_02_0559 - 11483798-11483988,11484076-11484163,11484288-114844... 28 3.9 03_02_0874 + 12017069-12018051,12018137-12018316,12018421-120186... 28 5.2 12_01_1022 - 10435409-10435564,10435950-10436219,10436820-104371... 27 6.8 10_08_0467 - 18143358-18143540,18144520-18144597,18144624-18145364 27 6.8 03_03_0244 - 15772156-15773964,15774190-15774711 27 6.8 01_05_0707 - 24468329-24468448,24468794-24468940,24469050-244691... 27 6.8 01_01_1096 - 8659091-8659459,8660730-8661050,8661416-8661694,866... 27 6.8 09_02_0357 + 7788946-7789326,7789620-7789997 27 9.0 06_03_1121 + 27767707-27768065,27768612-27769034,27770013-277701... 27 9.0 06_01_0784 - 5868545-5868888,5868990-5869085,5870313-5870394,587... 27 9.0 01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283,856... 27 9.0 01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902,467... 27 9.0 >02_02_0369 - 9505330-9505652,9507262-9507532,9507649-9507690, 9508416-9508458,9508853-9508860 Length = 228 Score = 52.8 bits (121), Expect = 2e-07 Identities = 21/44 (47%), Positives = 30/44 (68%), Gaps = 1/44 (2%) Frame = +2 Query: 41 RYYCEYCDNMMV-SSPSIVKTHNKGIAHQKLVQEHYQQFKDAET 169 RYYC+YCD + SPS+ K HN G H+ V+ +YQQF++ +T Sbjct: 3 RYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRTYYQQFEEQQT 46 >01_01_1054 + 8330081-8330137,8330229-8330321,8330445-8330504, 8330703-8330975,8331107-8331181,8331269-8331325, 8331409-8331549,8331656-8331706,8331795-8331944, 8331974-8332057,8332171-8332273,8332451-8332527, 8333469-8333704,8334000-8334078,8335123-8335218, 8335735-8335828,8336325-8336423,8336663-8337453 Length = 871 Score = 33.1 bits (72), Expect = 0.14 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +2 Query: 23 ECNMGKRYYCEYCDNMMVSSPSIVKTHNKGIAHQK 127 E +GK YYC+YC+ +P+ K H G H + Sbjct: 448 EMPLGK-YYCDYCEKQFQDTPAARKRHLDGAQHHR 481 >06_03_1309 + 29223197-29223240,29223358-29223592,29223695-29223783, 29223870-29223968,29224065-29224158,29224297-29224514, 29224861-29224967,29225298-29225472,29225596-29225743, 29226548-29226596,29228016-29228162,29229990-29229996, 29230417-29230482,29230773-29231991,29232073-29233149, 29233226-29233355,29233519-29233617,29233817-29233878, 29234429-29234533 Length = 1389 Score = 32.7 bits (71), Expect = 0.18 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +2 Query: 200 CSRFGQGSCQFGGICRYSH---YTREQLDELKEYVTTKNIIKQDFVQPSFQVLYQRLESE 370 C F +GSC++G CRY H + ++Q + K + QPSF +Q+ + + Sbjct: 8 CRNFQRGSCKYGAQCRYLHASPHQQQQQQQAKPNPFGFGTGSRQQQQPSFGSQFQQQQQQ 67 Query: 371 K 373 + Sbjct: 68 Q 68 >01_05_0420 + 21969797-21970939,21971307-21971369,21971488-21971616, 21972241-21972291,21972669-21972809,21972922-21973122, 21973201-21973419,21973582-21973700,21973772-21973862, 21975864-21975965,21976291-21976315,21976522-21976592 Length = 784 Score = 32.7 bits (71), Expect = 0.18 Identities = 20/61 (32%), Positives = 29/61 (47%) Frame = +2 Query: 74 VSSPSIVKTHNKGIAHQKLVQEHYQQFKDAETILAEEKDKKPCSRFGQGSCQFGGICRYS 253 V P +VK + + H K Q + +F T L + K PC+ + +GSC G C Y Sbjct: 426 VIKPKVVKVCHFYL-HGKCQQGNLCKFSHDTTPLTKSK---PCTHYARGSCLKGDDCPYD 481 Query: 254 H 256 H Sbjct: 482 H 482 Score = 28.3 bits (60), Expect = 3.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +2 Query: 194 KPCSRFGQGSCQFGGICRYSHYT 262 K C + G CQ G +C++SH T Sbjct: 433 KVCHFYLHGKCQQGNLCKFSHDT 455 >07_01_0281 - 2067696-2068862 Length = 388 Score = 32.3 bits (70), Expect = 0.24 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 200 CSRFGQGSCQFGGICRYSHYTREQ 271 CS++ +G C G CRYSH EQ Sbjct: 327 CSKWRKGRCHNGAACRYSHGEEEQ 350 >03_06_0523 + 34499533-34499705,34499808-34499917,34500037-34500224, 34500984-34501451 Length = 312 Score = 31.9 bits (69), Expect = 0.32 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 5/45 (11%) Frame = +2 Query: 137 EHYQQFKDAETILAEEKDKKP-----CSRFGQGSCQFGGICRYSH 256 +H ++K E EE KK C F +G C G CRYSH Sbjct: 110 DHVSKYKKKEEEDEEELQKKREARGVCYAFQKGECNRGASCRYSH 154 >12_02_0008 + 12239759-12239923,12240404-12240443,12241278-12241435, 12242400-12242462,12243149-12243268,12243388-12243684, 12245012-12245335,12246411-12246680 Length = 478 Score = 31.5 bits (68), Expect = 0.42 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 164 ETILAEEKDKKPCSRFGQ-GSCQFGGICRYSHYTREQL 274 E I E D+ C + + G C+FG +C++ H+ +E+L Sbjct: 336 ENIFPERPDQPECQFYMKTGDCKFGAVCKF-HHPKERL 372 >11_04_0274 - 15667178-15667444,15668352-15668678,15669430-15669563, 15669669-15669726,15669842-15669961,15670814-15670876, 15671388-15671539,15673002-15673116,15673907-15673981, 15674474-15674538,15675020-15675128 Length = 494 Score = 31.1 bits (67), Expect = 0.55 Identities = 12/38 (31%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +2 Query: 164 ETILAEEKDKKPCSRFGQ-GSCQFGGICRYSHYTREQL 274 E+I E D+ C + + G C+FG +C++ H+ +E++ Sbjct: 353 ESIFPERPDQPECQFYMKTGDCKFGAVCKF-HHPKERI 389 >08_01_0181 + 1530623-1531626,1531723-1531902,1531998-1532177, 1532363-1532442,1532528-1532701,1533001-1533118, 1533223-1533301 Length = 604 Score = 30.7 bits (66), Expect = 0.73 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 191 KKPCSRFGQGSCQFGGICRYSHY 259 ++PC F +G C+ G C YSH+ Sbjct: 214 RRPCHYFSKGICKNGQNCHYSHH 236 >01_07_0321 + 42715969-42716233,42716320-42716399,42716545-42716613, 42716710-42716791,42716902-42716996,42717129-42717203, 42717385-42717436,42717442-42717630,42717667-42717752, 42717827-42717902,42718001-42718164,42718307-42718426 Length = 450 Score = 30.7 bits (66), Expect = 0.73 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +2 Query: 41 RYYCEYCDNMMVSSPSIVKTHNKGIAHQKLVQEHYQQ 151 +Y CE CDN ++ + H +G H+K VQ Q+ Sbjct: 407 QYVCEACDNRVLRGTHEWEQHKQGRCHRKRVQRLKQK 443 >06_03_0766 - 24425486-24426245,24430766-24430855,24430951-24431070, 24431568-24431746,24432046-24432231,24432454-24432547, 24432679-24432743,24433652-24433987 Length = 609 Score = 30.3 bits (65), Expect = 0.97 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +2 Query: 194 KPCSRFGQGSCQFGGICRYSH 256 K C F +GSC FG C ++H Sbjct: 577 KLCENFNKGSCTFGDRCHFAH 597 >04_04_1500 + 34010819-34011016,34013267-34013308,34014195-34014204, 34014526-34014586,34014621-34014678,34015266-34015412, 34015643-34016205,34018942-34019728 Length = 621 Score = 30.3 bits (65), Expect = 0.97 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 194 KPCSRFGQGSCQFGGICRYSHYTREQ 271 K C F +G+C FG C ++H EQ Sbjct: 591 KLCENFVKGTCTFGDRCHFAHGENEQ 616 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 30.3 bits (65), Expect = 0.97 Identities = 10/32 (31%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 164 ETILAEEKDKKPCSRFGQ-GSCQFGGICRYSH 256 E + E D+ C + + G C+FG +C++ H Sbjct: 326 ENVFPERPDQPECQYYMKTGDCKFGAVCKFHH 357 >02_01_0703 + 5251901-5251950,5252783-5253554 Length = 273 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +2 Query: 194 KPCSRFGQGSCQFGGICRYSHYTRE 268 K C F +GSC FG C ++H E Sbjct: 242 KLCENFTKGSCTFGDRCHFAHGENE 266 >06_02_0136 + 12195422-12195435,12196047-12196122,12196896-12197707, 12197941-12198010,12199469-12199557,12199633-12199666 Length = 364 Score = 29.5 bits (63), Expect = 1.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 200 CSRFGQGSCQFGGICRYSH 256 C+ + +GSC +G CRY H Sbjct: 32 CTFYQKGSCSYGSRCRYDH 50 Score = 29.1 bits (62), Expect = 2.2 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +2 Query: 209 FGQGSCQFGGICRYSHYTRE-QLDEL 283 FG G+C FG C Y H R+ +L+E+ Sbjct: 310 FGTGTCPFGSSCFYKHAYRDGRLEEV 335 >02_05_0300 + 27681204-27681656,27681745-27681840,27681933-27682022, 27682126-27682227,27682310-27682456,27683608-27683748, 27683749-27683808,27685133-27685230,27685308-27685410, 27685954-27686037 Length = 457 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 194 KPCSRFGQGSCQFGGICRYSH 256 +PC F G C +G CRY H Sbjct: 112 RPCRYFLAGDCSYGEKCRYPH 132 >06_03_0253 + 18753901-18754278,18754873-18754968,18755167-18755376, 18756028-18756093,18756379-18756576,18756616-18756810, 18756968-18757014,18757147-18757234,18757331-18757681, 18758593-18759123 Length = 719 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = +2 Query: 176 AEEKDKKP----CSRFGQ-GSCQFGGICRYSHYTREQLDELKEY 292 AE+ ++P CS + + GSC+FG CR++H R + +EY Sbjct: 84 AEQFPRRPGEPDCSYYVKFGSCKFGMNCRFNHPPRMPVPPQQEY 127 >05_01_0578 + 5180538-5181385,5182480-5182595,5183397-5183605, 5184024-5184143,5184247-5184375,5184466-5184591, 5185550-5185667,5186471-5186680,5186788-5187100, 5187467-5187560,5187760-5187868,5188322-5188593, 5188684-5188811,5188977-5189211,5189794-5189982, 5190069-5190349,5190431-5190698,5190719-5190961, 5191598-5191680,5192484-5192493 Length = 1366 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 275 DELKEYVTTKNIIKQDFVQPSFQVLYQRLESEKTQESHVSDENQYWLDDNGISHILPW 448 DEL T++ + D P + L + LE+ + +ESH Y++ N S PW Sbjct: 862 DELPGPAPTQHSSQIDHSFPFLESLNEVLETNRAEESHCHVHRMYFMGPNTFSE--PW 917 >02_05_1041 - 33713561-33714564,33714844-33714904,33715640-33715951, 33716780-33716917 Length = 504 Score = 29.1 bits (62), Expect = 2.2 Identities = 27/100 (27%), Positives = 42/100 (42%), Gaps = 5/100 (5%) Frame = +2 Query: 200 CSRFGQGSCQFGGICRYSHYTREQLDELKEYVTTK---NIIKQDFVQPS--FQVLYQRLE 364 C F Q C+FG CR SH + LK++ T+ +++ + S L++R E Sbjct: 152 CKFFLQQRCRFGSNCRLSHGIVIPILSLKQFTPTRWQQSLVGSSILAASGHHSGLWRRAE 211 Query: 365 SEKTQESHVSDENQYWLDDNGISHILPWTYKSVFESYGEN 484 E + Q D+G S LP S+ E E+ Sbjct: 212 LESWDDD--LKVGQVVFQDDGSSARLPSDSLSISEYADES 249 >08_01_0244 + 2016548-2017101,2017392-2019681,2019785-2019817 Length = 958 Score = 28.7 bits (61), Expect = 3.0 Identities = 20/58 (34%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Frame = +2 Query: 197 PCSRFGQGSCQFGGICRYSHY--TREQLDELKEYVTTKNIIKQ--DFVQPSFQVLYQR 358 PC F G C+ G CR+ H R Q DE + + Q DF+ P Q Y R Sbjct: 234 PCRDFVAGRCRRGSNCRFPHEDGVRRQFDEHYPVDSREKYGHQNRDFMDPREQDDYLR 291 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 179 EEKDKKPCSRFGQGSCQFGGICRYSH 256 E + PC F +G C G CRY H Sbjct: 313 EYRSTMPCHDFVKGRCSRGANCRYVH 338 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 188 DKKPCSRFGQGSCQFGGICRYSHYTREQ 271 +K PC F G C+ G C Y H Q Sbjct: 375 NKNPCKFFANGGCRRGQNCPYLHEEASQ 402 >03_02_0709 + 10583621-10583626,10583711-10584712,10585304-10585669 Length = 457 Score = 28.7 bits (61), Expect = 3.0 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +2 Query: 200 CSRFGQGSCQFGGICRYSHYTRE 268 C+++ +G+C +G CR++H +E Sbjct: 388 CNKWERGACPYGARCRFAHGLQE 410 >07_03_1709 - 28873172-28873327,28873519-28873584,28874067-28874127, 28875406-28875462,28876301-28876531,28876685-28876799, 28876897-28877136,28877222-28877316,28877406-28877585, 28877663-28877839,28877920-28878890 Length = 782 Score = 28.3 bits (60), Expect = 3.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 194 KPCSRFGQGSCQFGGICRYSH 256 KPC + +G C+ G CR+ H Sbjct: 233 KPCLYYARGYCKNGSACRFVH 253 >03_05_0799 + 27809301-27811550 Length = 749 Score = 28.3 bits (60), Expect = 3.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 197 PCSRFGQGSCQFGGICRYSH 256 PC F +G C+ G +C Y+H Sbjct: 311 PCPDFRKGVCRRGDMCEYAH 330 >03_02_0875 + 12038365-12039329,12039417-12039593,12039651-12039893, 12040045-12040124,12040242-12040508,12040599-12040710, 12040757-12041071,12041357-12041366 Length = 722 Score = 28.3 bits (60), Expect = 3.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 194 KPCSRFGQGSCQFGGICRYSH 256 KPC + +G C+ G CR+ H Sbjct: 232 KPCLYYARGFCKNGSTCRFVH 252 >02_02_0559 - 11483798-11483988,11484076-11484163,11484288-11484405, 11484489-11484637,11484921-11484974,11485065-11485160, 11486092-11486242,11486300-11486382,11486577-11486695, 11487111-11487237 Length = 391 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 227 QFGGICRYSHYTREQLDELKEYVTTKNIIKQDFVQ 331 Q G+ HYTRE LDE+ T + ++ Q++V+ Sbjct: 180 QRAGVDLDVHYTREYLDEIVGSNTRRQMLYQEYVK 214 >03_02_0874 + 12017069-12018051,12018137-12018316,12018421-12018600, 12018718-12018797,12018999-12019259,12019360-12019474, 12019631-12019855,12020840-12020849 Length = 677 Score = 27.9 bits (59), Expect = 5.2 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 194 KPCSRFGQGSCQFGGICRYSH 256 KPC + +G C+ G CR+ H Sbjct: 237 KPCLYYARGFCKNGSSCRFVH 257 >12_01_1022 - 10435409-10435564,10435950-10436219,10436820-10437125, 10437932-10438057,10439825-10439893,10440443-10440487, 10440717-10440776,10441527-10441589,10442186-10442266, 10442494-10442916 Length = 532 Score = 27.5 bits (58), Expect = 6.8 Identities = 10/24 (41%), Positives = 16/24 (66%), Gaps = 1/24 (4%) Frame = +2 Query: 188 DKKPCSRFGQ-GSCQFGGICRYSH 256 D+ C+ +G+ G C+FG C Y+H Sbjct: 482 DQPVCTYYGRYGVCKFGPACAYNH 505 Score = 27.1 bits (57), Expect = 9.0 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 218 GSCQFGGICRYSHYTREQLDELK 286 GSC+FG C+++H R++ +K Sbjct: 121 GSCRFGMKCKFNHPARKKKSRVK 143 >10_08_0467 - 18143358-18143540,18144520-18144597,18144624-18145364 Length = 333 Score = 27.5 bits (58), Expect = 6.8 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 26 CNMGKRYYCEYCDNMMVSSPSIVKTHNKGIAHQKLVQEHYQ 148 C + K Y C + +S ++TH + QKL+QEH+Q Sbjct: 128 CGIRKHSYLNLCGRL--ASCDCIRTHMEA---QKLIQEHHQ 163 >03_03_0244 - 15772156-15773964,15774190-15774711 Length = 776 Score = 27.5 bits (58), Expect = 6.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +2 Query: 101 HNKGIAHQKLVQEHYQQFKDAETILAEEKD 190 H K + KLV+E + + T+LA E+D Sbjct: 272 HQKAVDELKLVKEEMRSTHEKHTVLASERD 301 >01_05_0707 - 24468329-24468448,24468794-24468940,24469050-24469103, 24469185-24469300,24470537-24470583,24470686-24470723, 24471050-24471268,24471504-24471602,24471675-24471728, 24472907-24473148,24474258-24474447 Length = 441 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 218 GSCQFGGICRYSHYTR 265 GSC+FG CR++H R Sbjct: 280 GSCKFGSTCRFNHPDR 295 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/49 (24%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 140 HYQQFKDAETILAEEKDKKPCSRFGQ-GSCQFGGICRYSHYTREQLDEL 283 ++++ + E E++ + C F + G C+FG C+++H +E+++ L Sbjct: 141 NWKEAANVEESYPEQEGEPDCPFFMKTGKCKFGSKCKFNH-PKEKVNAL 188 >01_01_1096 - 8659091-8659459,8660730-8661050,8661416-8661694, 8661781-8661897,8662142-8662210,8663204-8663397, 8663552-8663633 Length = 476 Score = 27.5 bits (58), Expect = 6.8 Identities = 9/22 (40%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +2 Query: 194 KPCSRFGQ-GSCQFGGICRYSH 256 +PC+ + Q G C++G C+Y H Sbjct: 357 QPCAYYAQNGYCRYGVACKYDH 378 Score = 27.1 bits (57), Expect = 9.0 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 158 DAETILAEEKDKKPCSRFGQ-GSCQFGGICRYSH 256 DA L E ++ C + + G+C FG CRY+H Sbjct: 51 DAAGRLPERPGEEDCVYYLRTGACGFGDRCRYNH 84 >09_02_0357 + 7788946-7789326,7789620-7789997 Length = 252 Score = 27.1 bits (57), Expect = 9.0 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +2 Query: 200 CSRFGQGSCQFGGICRYSHYTREQ 271 C ++ +G C G CRY+H +Q Sbjct: 41 CMKWREGRCHNGVACRYAHGEEDQ 64 >06_03_1121 + 27767707-27768065,27768612-27769034,27770013-27770175, 27770271-27770381,27770895-27770963,27771117-27771203, 27771967-27772752 Length = 665 Score = 27.1 bits (57), Expect = 9.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 188 DKKPCSRFGQGSCQFGGICRYSH 256 D K C+ + G C G CRY H Sbjct: 114 DVKECNMYKMGFCPNGPNCRYKH 136 >06_01_0784 - 5868545-5868888,5868990-5869085,5870313-5870394, 5870639-5870839,5871810-5871818 Length = 243 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/54 (22%), Positives = 28/54 (51%) Frame = +2 Query: 47 YCEYCDNMMVSSPSIVKTHNKGIAHQKLVQEHYQQFKDAETILAEEKDKKPCSR 208 +C++C + ++P ++TH G H+ V + + A+EK+++ +R Sbjct: 12 WCDFCKIYIANNPLSIRTHEIGKRHKDNVTKRLATMQKEGA--AKEKEQQQAAR 63 >01_01_1089 - 8560008-8560220,8560456-8560977,8561095-8561283, 8561377-8561642,8561967-8562111,8562411-8562530, 8562611-8562930,8564161-8564341,8564434-8564580, 8565186-8565497,8566303-8566450,8566592-8566765, 8567385-8567446,8567499-8567571,8567628-8567683, 8568370-8568645,8569541-8569588,8569870-8569991, 8570258-8570413,8571037-8571079,8572624-8572701, 8572972-8573070,8573168-8573209,8573302-8573304 Length = 1264 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 188 DKKPCSRFGQGSCQFGGICRYSHYTREQLDELKEYVT 298 + + C F GSC G C +SH +R K ++T Sbjct: 982 ENEMCVFFLNGSCNRGDTCHFSHSSRAPRPICKFFLT 1018 >01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902, 4675953-4676072,4676185-4676313,4676394-4676442, 4676899-4676970,4677574-4677707,4677798-4677915, 4678332-4678541,4678630-4678942,4679539-4679632, 4679854-4679962,4680243-4680514,4680597-4680724, 4680832-4681066,4681570-4681758,4681845-4682128, 4682218-4682398,4682486-4682728,4682904-4682986, 4683119-4683227,4687996-4688091,4688675-4688764, 4688881-4689129,4689233-4689412,4690179-4690250, 4691385-4691474,4691605-4691705,4691794-4691959 Length = 1757 Score = 27.1 bits (57), Expect = 9.0 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +2 Query: 275 DELKEYVTTKNIIKQDFVQPSFQVLYQRLESEKTQESHVSDENQYWLDDNGISHILPW 448 DEL T+ + D P + L + LE+ + +ESH Y++ N S PW Sbjct: 900 DELPGPAPTQQGSQIDHSFPFLESLNEVLETNRAEESHGHVHRMYFMGPNTFSE--PW 955 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,810,315 Number of Sequences: 37544 Number of extensions: 275873 Number of successful extensions: 800 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 798 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -