BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A21 (550 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34643| Best HMM Match : GLTT (HMM E-Value=3.6) 29 3.3 SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0) 28 4.4 >SB_34643| Best HMM Match : GLTT (HMM E-Value=3.6) Length = 399 Score = 28.7 bits (61), Expect = 3.3 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 251 CFTILKLFIILCHTMVISIR*FTLFKLYYIFCV 153 CFT+L + + C +V+ FTL + Y+ C+ Sbjct: 125 CFTLLVMCYLCCTLLVMDYLCFTLLVMGYLCCI 157 >SB_49315| Best HMM Match : Calreticulin (HMM E-Value=0) Length = 1086 Score = 28.3 bits (60), Expect = 4.4 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = -1 Query: 526 CDFSLLTM*LLAILYYTVCHTFRIFESEFDKLNNSVGKLT*I*FDYLRIQEFNI 365 C +LL LL +LY +C+T + + K+ S+ + + + QE N+ Sbjct: 920 CILALLPAALLVVLYSAICYTL-VRHGQLAKIRTSIANMAPTAYQKRKEQEHNV 972 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,442,138 Number of Sequences: 59808 Number of extensions: 220739 Number of successful extensions: 260 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 260 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -