BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A19 (552 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 23 1.8 EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 3.1 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 4.1 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 9.5 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.0 bits (47), Expect = 1.8 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 254 RYHTRGCILVLKCNSPRISQLFVVMFHQC*ELMFALDLVTVFG 126 R +RG I K + +I+ + V +F C DL+ VFG Sbjct: 235 RASSRGLIPRAKVKTIKITFVIVSVFILCWSPYIIFDLLQVFG 277 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -2 Query: 254 RYHTRGCILVLKCNSPRISQLFVVMFHQC*ELMFALDLVTVFG 126 R +RG I K + +++ + V +F C DL+ V+G Sbjct: 270 RASSRGIIPRAKIKTVKMTLVIVFVFVLCWSPYIVFDLLQVYG 312 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -1 Query: 282 LPWFL*VLLSLPHTGLYSGVEMQ 214 L W L +L SLP L+ ++Q Sbjct: 167 LAWLLSILFSLPTVFLFEEKQVQ 189 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 4.1 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -2 Query: 251 YHTRGCILVLKCNSPRISQLFV 186 Y RG VLKCN P FV Sbjct: 133 YVIRGNTAVLKCNIPSFVADFV 154 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +3 Query: 411 LCNLETALNSCFSL 452 +CNL N CF L Sbjct: 219 ICNLIDEFNECFGL 232 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,813 Number of Sequences: 336 Number of extensions: 3050 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13621010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -