BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A18 (507 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 23 1.6 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 4.8 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 23.0 bits (47), Expect = 1.6 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +2 Query: 245 DNWDLNIYPTTRFASEYGVQSLPSLFTMRTATKDQKDFSIDSEYSKHRQHQP 400 +N DL +F YG Q P+ R A + + +++ ++ RQH P Sbjct: 63 NNSDLRCKRKIQFMP-YGPQQQPASVARRNARERNRVKQVNNGFATLRQHIP 113 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.4 bits (43), Expect = 4.8 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 71 ILIGTRQSQNSTNTNF 24 ++I +QNSTN NF Sbjct: 345 VMIQFEMTQNSTNINF 360 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,449 Number of Sequences: 336 Number of extensions: 2410 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12049355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -