BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A17 (323 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81526-2|CAB04265.1| 229|Caenorhabditis elegans Hypothetical pr... 56 6e-09 U97009-9|AAC69027.1| 225|Caenorhabditis elegans Hypothetical pr... 53 4e-08 AF047659-15|AAC04426.1| 493|Caenorhabditis elegans Hypothetical... 27 2.3 AF022967-12|AAB69873.2| 467|Caenorhabditis elegans Hypothetical... 27 2.3 Z82089-5|CAD91717.1| 4541|Caenorhabditis elegans Hypothetical pr... 26 5.4 Z82089-4|CAB54513.2| 4648|Caenorhabditis elegans Hypothetical pr... 26 5.4 Z82089-3|CAB05004.2| 634|Caenorhabditis elegans Hypothetical pr... 26 5.4 Z82089-2|CAB05003.2| 4530|Caenorhabditis elegans Hypothetical pr... 26 5.4 Z81499-7|CAD91628.1| 4541|Caenorhabditis elegans Hypothetical pr... 26 5.4 Z81499-6|CAB54224.2| 4648|Caenorhabditis elegans Hypothetical pr... 26 5.4 Z81499-5|CAB04091.2| 634|Caenorhabditis elegans Hypothetical pr... 26 5.4 Z81499-4|CAB04090.2| 4530|Caenorhabditis elegans Hypothetical pr... 26 5.4 AF025454-1|AAC71152.2| 378|Caenorhabditis elegans Hypothetical ... 26 5.4 AF026210-3|AAB71286.3| 382|Caenorhabditis elegans Hypothetical ... 26 7.2 AL032620-1|CAA21487.1| 354|Caenorhabditis elegans Hypothetical ... 25 9.5 >Z81526-2|CAB04265.1| 229|Caenorhabditis elegans Hypothetical protein F33H2.3 protein. Length = 229 Score = 56.0 bits (129), Expect = 6e-09 Identities = 29/59 (49%), Positives = 37/59 (62%) Frame = +1 Query: 67 MEKRLVLELRGRNPSQVKELNLDNCRSTNIVGLSDQYTNLEILSLNNAGLTNLKGFPSI 243 M + V ELR R+P+ V L LDN I GL+DQ NLE+LS+ GLT L GFP++ Sbjct: 4 MAEIYVKELRERDPATVDTLFLDNAEDGQIGGLTDQLINLEMLSMVKCGLTTLAGFPTL 62 >U97009-9|AAC69027.1| 225|Caenorhabditis elegans Hypothetical protein T19H12.2 protein. Length = 225 Score = 53.2 bits (122), Expect = 4e-08 Identities = 27/57 (47%), Positives = 35/57 (61%) Frame = +1 Query: 67 MEKRLVLELRGRNPSQVKELNLDNCRSTNIVGLSDQYTNLEILSLNNAGLTNLKGFP 237 ME+ ELRGR P V L LDN + I G++++ T LE+LS+ GLT LKG P Sbjct: 1 MEEVYASELRGREPETVDTLFLDNTQGGVIGGINEKLTKLELLSMVKCGLTTLKGMP 57 >AF047659-15|AAC04426.1| 493|Caenorhabditis elegans Hypothetical protein K07H8.1 protein. Length = 493 Score = 27.5 bits (58), Expect = 2.3 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +1 Query: 109 SQVKELNLDNCRSTNIVGLSDQYTNLEILSLNNAGLTNLKGF 234 S++ L+L++ + + + NL LS+ N G+T+L GF Sbjct: 249 SRLTSLDLEDNPFKTLDSIHGTFPNLTQLSVANCGITSLNGF 290 >AF022967-12|AAB69873.2| 467|Caenorhabditis elegans Hypothetical protein C13A2.1 protein. Length = 467 Score = 27.5 bits (58), Expect = 2.3 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +3 Query: 213 SYKSKRFPKHLPKLRKLELSDNRISN 290 +Y S FP H+P++ K +S+N I++ Sbjct: 299 NYTSLHFPSHVPEIEKYIVSENVITH 324 >Z82089-5|CAD91717.1| 4541|Caenorhabditis elegans Hypothetical protein ZK270.2e protein. Length = 4541 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 88 ELRGRNPSQVKELNLDNCRSTNIVGL 165 E+RG+ PS+ + LD+C+ + G+ Sbjct: 204 EMRGQTPSEAENQFLDHCKHLALYGI 229 >Z82089-4|CAB54513.2| 4648|Caenorhabditis elegans Hypothetical protein ZK270.2d protein. Length = 4648 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 88 ELRGRNPSQVKELNLDNCRSTNIVGL 165 E+RG+ PS+ + LD+C+ + G+ Sbjct: 193 EMRGQTPSEAENQFLDHCKHLALYGI 218 >Z82089-3|CAB05004.2| 634|Caenorhabditis elegans Hypothetical protein ZK270.2b protein. Length = 634 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 88 ELRGRNPSQVKELNLDNCRSTNIVGL 165 E+RG+ PS+ + LD+C+ + G+ Sbjct: 193 EMRGQTPSEAENQFLDHCKHLALYGI 218 >Z82089-2|CAB05003.2| 4530|Caenorhabditis elegans Hypothetical protein ZK270.2a protein. Length = 4530 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 88 ELRGRNPSQVKELNLDNCRSTNIVGL 165 E+RG+ PS+ + LD+C+ + G+ Sbjct: 193 EMRGQTPSEAENQFLDHCKHLALYGI 218 >Z81499-7|CAD91628.1| 4541|Caenorhabditis elegans Hypothetical protein ZK270.2e protein. Length = 4541 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 88 ELRGRNPSQVKELNLDNCRSTNIVGL 165 E+RG+ PS+ + LD+C+ + G+ Sbjct: 204 EMRGQTPSEAENQFLDHCKHLALYGI 229 >Z81499-6|CAB54224.2| 4648|Caenorhabditis elegans Hypothetical protein ZK270.2d protein. Length = 4648 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 88 ELRGRNPSQVKELNLDNCRSTNIVGL 165 E+RG+ PS+ + LD+C+ + G+ Sbjct: 193 EMRGQTPSEAENQFLDHCKHLALYGI 218 >Z81499-5|CAB04091.2| 634|Caenorhabditis elegans Hypothetical protein ZK270.2b protein. Length = 634 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 88 ELRGRNPSQVKELNLDNCRSTNIVGL 165 E+RG+ PS+ + LD+C+ + G+ Sbjct: 193 EMRGQTPSEAENQFLDHCKHLALYGI 218 >Z81499-4|CAB04090.2| 4530|Caenorhabditis elegans Hypothetical protein ZK270.2a protein. Length = 4530 Score = 26.2 bits (55), Expect = 5.4 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +1 Query: 88 ELRGRNPSQVKELNLDNCRSTNIVGL 165 E+RG+ PS+ + LD+C+ + G+ Sbjct: 193 EMRGQTPSEAENQFLDHCKHLALYGI 218 >AF025454-1|AAC71152.2| 378|Caenorhabditis elegans Hypothetical protein F34D6.1 protein. Length = 378 Score = 26.2 bits (55), Expect = 5.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 210 WSYKSKRFPKHLPKLRKLELSDN 278 W Y +K F K+ PK+ + L DN Sbjct: 189 WHYLTKFFEKYKPKIDDMSLYDN 211 >AF026210-3|AAB71286.3| 382|Caenorhabditis elegans Hypothetical protein F48A11.4 protein. Length = 382 Score = 25.8 bits (54), Expect = 7.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 20 DESTVTYSVNSTDLQKWKRGW 82 D T YS++ TDL +W W Sbjct: 89 DAKTKYYSIDLTDLARWHLAW 109 >AL032620-1|CAA21487.1| 354|Caenorhabditis elegans Hypothetical protein Y36E3A.1 protein. Length = 354 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 81 QPLFHFCKSVEFTLYVTVDSSIK 13 Q LFHF K + L +TVD +IK Sbjct: 264 QSLFHFEKFLIHKLRITVDDAIK 286 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,149,032 Number of Sequences: 27780 Number of extensions: 135495 Number of successful extensions: 332 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 387641448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -