BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A16 (500 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 25 0.29 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 24 0.88 DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase rever... 23 1.2 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 23 1.2 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 3.6 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 4.7 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 21 8.2 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 25.4 bits (53), Expect = 0.29 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -2 Query: 175 MNCELKGLTNQKRRGTLTSSVSVRQLG--KSERDGYTFIILLLRYFCSFLATF 23 ++ E+ G N+ + G L ++ +SER+ Y ++ L+ FC F+ F Sbjct: 102 LDIEILGYVNKAKFGKLLINLYTINYNFKESERNDYVSLLQLVFVFCYFIYLF 154 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 23.8 bits (49), Expect = 0.88 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -2 Query: 130 TLTSSVSVRQLGKSERDGYTFIILLLRYFCSFLATFYSLRFII 2 TLT V + + + YT+I L++ F+A F++ I+ Sbjct: 33 TLTLLVILSSIDRPYLKSYTYIKLVVSVLMDFIAYFFNFWTIL 75 >DQ494421-1|ABF55372.1| 73|Tribolium castaneum telomerase reverse transcriptase protein. Length = 73 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 248 VSITFNSMAEIVLSIFRALKSHET 177 V+ +NS+ I L FR K H+T Sbjct: 19 VNSKYNSILNIALKNFRLCKKHKT 42 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 248 VSITFNSMAEIVLSIFRALKSHET 177 V+ +NS+ I L FR K H+T Sbjct: 19 VNSKYNSILNIALKNFRLCKKHKT 42 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.8 bits (44), Expect = 3.6 Identities = 14/58 (24%), Positives = 30/58 (51%) Frame = -2 Query: 190 SRTRRMNCELKGLTNQKRRGTLTSSVSVRQLGKSERDGYTFIILLLRYFCSFLATFYS 17 +R + + LK T+ + GTL ++ ++ G+T I++L + S L++ Y+ Sbjct: 188 NRFKELQKYLKIETSCRYVGTLYRILTTMMEMVNDIFGWTLILILAKCITSSLSSLYT 245 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 127 LTSSVSVRQLGKSERDGYTFIILLLRYFCSFLA 29 LTSSV++ S +T I C F+A Sbjct: 54 LTSSVTLHVCFNSYMYAFTHIFFFFAICCDFIA 86 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 20.6 bits (41), Expect = 8.2 Identities = 10/42 (23%), Positives = 19/42 (45%) Frame = -1 Query: 131 HANIVRLCPTTGQEREGRLHIYYTITTIFLFVPCNILQFTFY 6 H N+V++ L ++ T+T I L I+ + F+ Sbjct: 237 HKNLVKVAKDHNSLYSLHLLLWITVTFILLVGDSYIVMYVFF 278 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,589 Number of Sequences: 336 Number of extensions: 1890 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -