BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A16 (500 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0108 - 5361431-5362405 29 2.1 08_02_0580 - 18953208-18953513,18953668-18953868,18953929-189540... 27 8.5 >10_02_0108 - 5361431-5362405 Length = 324 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +3 Query: 90 LLPSCRTETDDVSVPRRF*LVNPLSSQFIRLVR 188 LL C T D +S+PR F + NP+S + + LVR Sbjct: 128 LLLLCSTFNDRMSIPRNFVVANPVSGRSV-LVR 159 >08_02_0580 - 18953208-18953513,18953668-18953868,18953929-18954009, 18954096-18954410,18954493-18954636,18954733-18954822, 18954907-18954983,18955122-18955182,18955264-18955490, 18955581-18955740,18955825-18956025,18956114-18956209, 18956380-18956565,18956641-18956810,18957044-18957275, 18958652-18959029 Length = 974 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -3 Query: 435 KNIIFLAKHHIARSFDKCIKYIFIFFIESLNLDMERLFNYTRAYK 301 KN +H + S +FIF I ++ + F+YT AY+ Sbjct: 20 KNATLTWRHRRSASLQLLSSLVFIFLIFCIDRAIRSRFSYTTAYR 64 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,306,397 Number of Sequences: 37544 Number of extensions: 161352 Number of successful extensions: 399 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 398 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -