BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A16 (500 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D87467-1|BAA13406.2| 583|Homo sapiens KIAA0277 protein. 30 3.9 BC039203-1|AAH39203.1| 444|Homo sapiens RAPGEF5 protein protein. 30 3.9 >D87467-1|BAA13406.2| 583|Homo sapiens KIAA0277 protein. Length = 583 Score = 30.3 bits (65), Expect = 3.9 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -3 Query: 150 PIRNDAAR*HRPSLSDNWARARGTVTHLLYYYYDIFVRSLQHSTVYV 10 P + + A H+ SL +NW + RGTVT + +++ +HS V V Sbjct: 216 PQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYI--TEHSYVSV 260 >BC039203-1|AAH39203.1| 444|Homo sapiens RAPGEF5 protein protein. Length = 444 Score = 30.3 bits (65), Expect = 3.9 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = -3 Query: 150 PIRNDAAR*HRPSLSDNWARARGTVTHLLYYYYDIFVRSLQHSTVYV 10 P + + A H+ SL +NW + RGTVT + +++ +HS V V Sbjct: 213 PQKKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYI--TEHSYVSV 257 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,900,619 Number of Sequences: 237096 Number of extensions: 953089 Number of successful extensions: 1485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1485 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4593178062 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -