BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A16 (500 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 1.8 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 2.4 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 21 7.2 AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-lik... 21 7.2 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.5 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.5 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.5 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 1.8 Identities = 11/46 (23%), Positives = 25/46 (54%) Frame = -2 Query: 256 HILYPSRSIRWLKSF*VYLER*SRTRRMNCELKGLTNQKRRGTLTS 119 HIL P++ +++ +YL++ + + + +NQ+R G +S Sbjct: 81 HILSPTQLQSFMQQHSLYLQQQQQQHHQDSSSEHASNQERFGYFSS 126 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.6 bits (46), Expect = 2.4 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 71 IYYTITTIFLFVPCNILQFTFYN 3 I Y+ + F ++PC I+ F +YN Sbjct: 344 IIYSSLSSF-YIPCIIMVFLYYN 365 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 21.0 bits (42), Expect = 7.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 134 RHANIVRLCPTTGQEREGRLHIYYTITTIFL 42 RH +IVRL G L ++ TTI L Sbjct: 109 RHKHIVRLVTAIGDAYGVALLLHMLTTTITL 139 >AF134818-1|AAD40234.1| 130|Apis mellifera lambda crystallin-like protein protein. Length = 130 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 381 IKYIFIFFIESLNLDMERLFNYTRAYK 301 ++Y F+ E+ +L+ E + Y YK Sbjct: 45 MRYAFLGAFEAAHLNAEGMKKYCETYK 71 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 404 IWCLAKKIMFLISFI 448 IW LA ++F+ SF+ Sbjct: 7 IWTLAVNVLFVNSFL 21 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 404 IWCLAKKIMFLISFI 448 IW LA ++F+ SF+ Sbjct: 7 IWTLAVNVLFVNSFL 21 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +2 Query: 404 IWCLAKKIMFLISFI 448 IW LA ++F+ SF+ Sbjct: 7 IWTLAVNVLFVNSFL 21 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,067 Number of Sequences: 438 Number of extensions: 2323 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -