BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A15 (583 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 26 0.20 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.5 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 22 4.4 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 7.6 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 7.6 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 26.2 bits (55), Expect = 0.20 Identities = 11/21 (52%), Positives = 18/21 (85%) Frame = -1 Query: 463 FGRLLCSLYSIHYHYSKEKKR 401 FG+LL +LY+I+Y++ KE +R Sbjct: 115 FGKLLINLYTINYNF-KESER 134 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 144 VRDFHTSPLPTFPGFSLGRLDHLVRKCIPLQKK 46 VR+ + +P G +G L + +C+PLQKK Sbjct: 42 VRELGSQWIPDL-GVPIGVLYCMKCECVPLQKK 73 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 21.8 bits (44), Expect = 4.4 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -2 Query: 471 KVYLEDYFALYTLFII 424 K+Y +YF +Y FI+ Sbjct: 428 KLYAVEYFQMYAQFIV 443 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 511 GPPRSGQCF 485 GP +SGQCF Sbjct: 49 GPGQSGQCF 57 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 7.6 Identities = 6/23 (26%), Positives = 15/23 (65%) Frame = +2 Query: 506 GSLWFAIIDIQDRFGAISMLMMC 574 G ++ +DI+D +G + + ++C Sbjct: 243 GQIYGIKVDIRDAYGNVKIPVLC 265 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,378 Number of Sequences: 336 Number of extensions: 3864 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -