BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A15 (583 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 5.5 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 9.5 AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal prot... 23 9.5 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 5.5 Identities = 11/49 (22%), Positives = 21/49 (42%) Frame = -2 Query: 576 SHIINIEMAPNLSWISIMANHKDPPAADSASTTVTKVYLEDYFALYTLF 430 +++ ++A WI IM + D T +Y+ YF + +F Sbjct: 1502 AYLCLFQVATFKGWIQIMNDAIDSRDVGKQPIRETNIYMYLYFVFFIIF 1550 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 22.6 bits (46), Expect = 9.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 466 YFRDSRRSTVRCGGVLMVCHY 528 Y++ S R CGGVL+ Y Sbjct: 134 YYKGSNRYGFHCGGVLIHNQY 154 >AF079312-1|AAC28093.1| 271|Anopheles gambiae 60S ribosomal protein rpL7a protein. Length = 271 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 61 NAFTH*MVQPTQGEPRECWK 120 N FT + +PT + +CWK Sbjct: 87 NQFTQTLDKPTAQQVMKCWK 106 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,802 Number of Sequences: 2352 Number of extensions: 15203 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -