BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A15 (583 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17990.1 68417.m02677 hypothetical protein contains Pfam prof... 31 0.74 At1g11100.1 68414.m01271 SNF2 domain-containing protein / helica... 27 9.1 >At4g17990.1 68417.m02677 hypothetical protein contains Pfam profile PF04776: Protein of unknown function (DUF626) Length = 265 Score = 30.7 bits (66), Expect = 0.74 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = -2 Query: 537 WISIMANHKDPPAADSASTTVTKVYLEDYFALYTLFIIIIRKK 409 +I+++A KDP A S T TKV EDY + TL + + R K Sbjct: 117 YITLVA--KDPSAGGSLVTFQTKVVHEDYSKINTLTVYLARLK 157 >At1g11100.1 68414.m01271 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-related similar to RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1226 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 325 YVNKIVGHQSDTGATRSSALLCRIAP 248 Y+N + G+ S GAT++S+L+ +P Sbjct: 159 YLNNMPGNDSGIGATQNSSLMSHFSP 184 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,585,213 Number of Sequences: 28952 Number of extensions: 331295 Number of successful extensions: 730 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -