BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A14 (554 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 26 0.95 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 3.9 Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL... 23 5.1 CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 23 8.9 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 25.8 bits (54), Expect = 0.95 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 428 AREAVRHFGPAPGAPRSHTKPYV 496 A E +R + PAP R+ TKPY+ Sbjct: 387 ANETLRKWTPAPFLDRTCTKPYM 409 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 3.9 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 281 EQCKASHHWRLCQ 243 +QCK HH +LC+ Sbjct: 397 QQCKRKHHSKLCK 409 >Z69976-1|CAA93816.1| 204|Anopheles gambiae ribosomal protein RL10 protein. Length = 204 Score = 23.4 bits (48), Expect = 5.1 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = +2 Query: 368 QLALRAPTGRKTVLVQGRRNAREAVRHFGPAPGAPRSH----TKPY 493 +L +A TG ++ R R+ H G G P+SH KPY Sbjct: 50 RLGYKAKTGFSIFRIRVRCGGRKRPVHKGCTYGKPKSHGVNQLKPY 95 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 22.6 bits (46), Expect = 8.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -2 Query: 193 QTGQRNRRSVDTAHKQSP 140 +T R S+DT+HK +P Sbjct: 44 ETAHRMAESMDTSHKPNP 61 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 592,561 Number of Sequences: 2352 Number of extensions: 12144 Number of successful extensions: 28 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 51722361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -