BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_A11 (575 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 2.3 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 3.1 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 5.4 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 9.4 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.6 bits (51), Expect = 2.3 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +1 Query: 97 GLGESGREGS--PVQSKRKGHERETHRSDG 180 G G G EGS P + KRKG E++ +S G Sbjct: 922 GGGSGGEEGSGAPKERKRKG-EKKPRKSQG 950 Score = 23.0 bits (47), Expect = 7.1 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = +1 Query: 106 ESGRE-GSPVQSKRKGHERETHRSDGEQENETSHSQ 210 ESG E G+P +++ + SDG Q S S+ Sbjct: 1035 ESGGESGAPATKRKRRIASDEEDSDGSQRRSRSRSR 1070 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.2 bits (50), Expect = 3.1 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 136 SKRKGHERETHRSDGEQENETS 201 S++K H+R DG+Q+N S Sbjct: 843 SEKKHHKRSKRVKDGKQQNHVS 864 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.4 bits (48), Expect = 5.4 Identities = 9/36 (25%), Positives = 18/36 (50%) Frame = +2 Query: 257 FTFDHSYWSFDNDDAHYASQEQVFADLGLDVIDSAF 364 F + SY++ DN H+ ++ G+D+ + F Sbjct: 178 FRDNSSYYTIDNKRVHFKEVSKLLKQHGIDLDHNRF 213 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 353 DSAFEGYNACVFAYGQTG 406 D++ EGY ACV+ G Sbjct: 1051 DASEEGYGACVYVRSTNG 1068 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 595,733 Number of Sequences: 2352 Number of extensions: 11977 Number of successful extensions: 24 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -